EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_HUMAN (L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 SV=2)

HSP 1 Score: 80.4925 bits (197), Expect = 1.476e-14
Identity = 65/237 (27.43%), Postives = 111/237 (46.84%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA  G+GR     L   G R+VA +R    L SL  E        +  + V+L           + + A  + G +D LVNNA V+  ++  L++T+E ++   + NL     VS+ V   +      G+++N+SS    S+  +     Y S+K  L+ +TK ++LELG HKIRVN++ P +  + + +                PL  F   +  + +++ +L+ D S M  G+
Sbjct:   13 TGAGKGIGRGTVQALHATGARVVAVSRTQADLDSLVREC-----PGIEPVCVDL-------GDWEATERALGSVGPVDLLVNNAAVA-LLQPFLEVTKEAFDRSFEVNLRAVIQVSQIVARGLIARGVPGAIVNVSS--QCSQRAVTNHSVYCSTKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTMLNRIPLGKFAEVEHVVNAIL-FLLSDRSGMTTGS 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: SDH_AGRT5 (Serine 3-dehydrogenase OS=Agrobacterium tumefaciens (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.927e-14
Identity = 56/190 (29.47%), Postives = 97/190 (51.05%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TGA+SG G+       K G +++   RR +RL++L  E+    G +   +A ++    +  A E ++    + F  ID LVNNAG++        +  ++W  ++ TN+TG   ++ ++   +    Q+G V+N+SS+AA       GG  Y  +KA L   +  L  +L    +RV SI PG+ ++E T
Sbjct:    8 TGATSGFGQATARRFVKEGWKVIGTGRRAERLEALAAEL----GQAFHGIAFDI---TDEDATEKALAALPDGFRDIDILVNNAGLALGTAPAPQVALKDWQTMVDTNITGLLNITHHLLPTL--IKQKGIVVNLSSVAA--HYPYLGGNVYGGTKAFLRQFSLGLRSDLHGKGVRVTSIEPGMCETEFT 186          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: LVR_LEIAQ (Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.927e-14
Identity = 67/243 (27.57%), Postives = 113/243 (46.50%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVAS------RTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG  SGLGR   + LA  G ++       + L++    +  ++      +    DVS + A +E  V    E FGRID   NNAG+ G        T  E++ ++  NL G +L  + V   MR+    G V+N +S+    RG +     YA++K G+  +T+  ++E G + IR+N+I PG   + + E  MK+    N         +  P + +G   P + ++V +L+ D +     T
Sbjct:   19 TGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAV-LETAPDAEVLTTVADVS-DEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQG-SGMVVNTASVGGI-RG-IGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEA-PEIAAVVAFLLSDDASYVNAT 255          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HDHA_CLOSO (NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.927e-14
Identity = 61/242 (25.21%), Postives = 119/242 (49.17%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLT---EEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP--GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            T A+ G+G    + LA+ G  +    RR++  + +CD+  K+ G  ++ +  +   + N    +  +    +  G+ID LVNN G +G  +  LDL    E+ +  +   N+   + +SK +   M + N+ GS++NISS+     G +P    + Y  SK+G+N +TK ++++   + IR N++ PGL  ++     M  ++  +  S   PL   G  +    S++ ++  + S    G+
Sbjct:   12 TSATRGIGLASAIKLAQNGAIVYMGVRRLEATQEICDKY-KEEGLILKPVFFD---AYNIDIYKEMIDTIIKNEGKIDILVNNFG-TGRPEKDLDLVNGDEDTFFELFNYNVGSVYRLSKLIIPHMIE-NKGGSIVNISSVG----GSIPDISRIGYGVSKSGVNNITKQIAIQYAKYGIRCNAVLPGLIATDAAMNSMPDEFRKSFLSHV-PLNRIGNPEDIANSVLFFVPSEDSSYITGS 242          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_HUMAN (Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.927e-14
Identity = 61/202 (30.20%), Postives = 99/202 (49.01%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRA---MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA+SGLG+E       AG ++V   R    L+ L  E+     + V+      V  D++ +GA +  + ++  + FG +D LVNNAG+S  G +   +D T +    +M+TN  G   ++K +   M    Q G ++ ISSI    +  +P   AYA+SK    A   CL  E+  ++I V  I PG   + ++   +  D
Sbjct:   58 TGATSGLGKECAKVFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEIL-QCFGYVDILVNNAGISYRGTI---MDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQ-GHIVAISSIQG--KMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITAD 252          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DHB8_HUMAN (Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 1.927e-14
Identity = 66/241 (27.39%), Postives = 114/241 (47.30%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAA----ARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA SG+GR   + LA  G  + A     A   + ++ L    +K+        A + DVS   AA    ++     F R  ++V +       +  L ++E++W+ ++  NL G++LV++     +      GS+INISSI         G   YA+SKAG+  +T+  + ELG H IR NS+ PG   + +T+ + +K  + +  +   P+   G  +  +  +V +L  + S    GT
Sbjct:   17 TGAGSGIGRAVSVRLAGEGATVAACDLDRAAAQETVRLLGGPGSKEGPPRGNHAAFQADVSEARAA-RCLLEQVQACFSRPPSVVVSCAGITQDEFLLHMSEDDWDKVIAVNLKGTFLVTQAAAQALVSNGCRGSIINISSIVGKVGNV--GQTNYAASKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKVPQK--VVDKITEMIPMGHLGDPED-VADVVAFLASEDSGYITGT 251          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDUD_ECOLI (2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=3 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.517e-14
Identity = 63/237 (26.58%), Postives = 111/237 (46.84%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRG-QLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPG 709
            TG  +GLG+   L LA+AGC IV        +    + I + +    R +++  D+      I   +  A   FG ID LVNNAG+    +  L+ +E++W+ +M  N+   + +S+            G +INI+S+ +   G ++P   +Y +SK+G+  +T+ ++ E   H I VN+I PG   +  T+ L   +  +       P   +G     +  +V +L   +SD   G
Sbjct:   16 TGCDTGLGQGMALGLAQAGCDIVGI-----NIVEPTETIEQVTALGRRFLSLTADLRKIDG-IPALLDRAVAEFGHIDILVNNAGLIRR-EDALEFSEKDWDDVMNLNIKSVFFMSQAAAKHFIAQGNGGKIINIASMLSFQGGIRVP---SYTASKSGVMGVTRLMANEWAKHNINVNAIAPGYMATNNTQQLRADEQRSAEILDRIPAGRWGLPSDLMGPIV-FLASSASDYVNG 241          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: KDSR_BOVIN (3-ketodihydrosphingosine reductase OS=Bos taurus GN=KDSR PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.517e-14
Identity = 61/185 (32.97%), Postives = 94/185 (50.81%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRA-MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLP--GGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICP 547
            TG SSG+G+   ++  K G  I   AR  D+L     EI K S +  +  + + +DVS + + +EN ++ A E  G +D LVN AG+S + K   DL    +  +M  N  GS   S+ V   M++  + G V+ +SS A    GQL   G  AY+SSK  L  + + L +E+  + + V    P
Sbjct:   38 TGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEKHSINDKQVVLCISVDVSQDYSQVENVIKQAQEKLGPVDMLVNCAGMSLSGKFE-DLEVSTFERLMSINYLGSVYPSRAVIATMKE-RRMGRVVFVSSQA----GQLGLFGYTAYSSSKFALRGLAEALQMEVKPYNVYVTVAYP 216          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: HCD2_DROME (3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 2.517e-14
Identity = 66/206 (32.04%), Postives = 109/206 (52.91%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKS-----PLDLTEEEWNHIMKTNLTGSWLVSKYVCIRM--RDANQEGS---VINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TG +SGLGR     LAK G  ++ A    D   S  +E+ K+ G  V  + V +DV++    +  ++Q A + FGR+D  VN AG + AVK+      +    E++  ++  N  G++ V +     M   + NQ+G    ++N +S+AA   GQ+ G  AY++SKA +  MT  ++ +L    IR+ +I PGLF + +   L +K
Sbjct:   10 TGGASGLGRATAERLAKQGASVILA----DLPSSKGNEVAKELGDKV--VFVPVDVTSE-KDVSAALQTAKDKFGRLDLTVNCAGTATAVKTFNFNKNVAHRLEDFQRVININTVGTFNVIRLSAGLMGANEPNQDGQRGVIVNTASVAAFD-GQI-GQAAYSASKAAVVGMTLPIARDLSTQGIRICTIAPGLFNTPMLAALPEK 206          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DRS7B_PONAB (Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 2.517e-14
Identity = 61/202 (30.20%), Postives = 99/202 (49.01%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRA---MAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVS--GAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKD 592
            TGA+SGLG+E       AG ++V   R    L+ L  E+     + V+      V  D++ +GA +  + ++  + FG +D LVNNAG+S  G +   +D T +    +M+TN  G   ++K +   M    Q G ++ ISSI    +  +P   AYA+SK    A   CL  E+  ++I V  I PG   + ++   +  D
Sbjct:   58 TGATSGLGKECAKVFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEIL-QCFGYVDILVNNAGISYRGTI---MDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQ-GHIVAISSIQG--KISIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAVTAD 252          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
DCXR_HUMAN1.476e-1427.43L-xylulose reductase OS=Homo sapiens GN=DCXR PE=1 ... [more]
SDH_AGRT51.927e-1429.47Serine 3-dehydrogenase OS=Agrobacterium tumefacien... [more]
LVR_LEIAQ1.927e-1427.57Levodione reductase OS=Leifsonia aquatica GN=lvr P... [more]
HDHA_CLOSO1.927e-1425.21NADP-dependent 7-alpha-hydroxysteroid dehydrogenas... [more]
DRS7B_HUMAN1.927e-1430.20Dehydrogenase/reductase SDR family member 7B OS=Ho... [more]
DHB8_HUMAN1.927e-1427.39Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens ... [more]
KDUD_ECOLI2.517e-1426.582-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=E... [more]
KDSR_BOVIN2.517e-1432.973-ketodihydrosphingosine reductase OS=Bos taurus G... [more]
HCD2_DROME2.517e-1432.043-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophi... [more]
DRS7B_PONAB2.517e-1430.20Dehydrogenase/reductase SDR family member 7B OS=Po... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top