EY659229

Overview
NameEY659229
Unique NameEY659229
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length909
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: ACT3_STRCO (Putative ketoacyl reductase OS=Streptomyces coelicolor GN=actIII PE=1 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 4.587e-16
Identity = 63/189 (33.33%), Postives = 99/189 (52.38%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGS--VINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKS 562
            TGA+SG+G E    L K G R+   AR  + L++   E+ +   + V A     DV +    IE  V    E +G +D LVNNAG  G   +  +L +E W  +++TNLTG + V+K V ++     + G+  ++NI+S     +  +     Y++SK G+   TK L LEL    I VN++CPG  ++
Sbjct:   12 TGATSGIGLEIARRLGKEGLRVFVCARGEEGLRTTLKELRE---AGVEADGRTCDVRSV-PEIEALVAAVVERYGPVDVLVNNAGRPGG-GATAELADELWLDVVETNLTGVFRVTKQV-LKAGGMLERGTGRIVNIASTGG--KQGVVHAAPYSASKHGVVGFTKALGLELARTGITVNAVCPGFVET 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YOXD_BACSU (Uncharacterized oxidoreductase yoxD OS=Bacillus subtilis GN=yoxD PE=3 SV=2)

HSP 1 Score: 84.7297 bits (208), Expect = 7.825e-16
Identity = 63/192 (32.81%), Postives = 98/192 (51.04%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGV--AYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEIT 571
            TG   G+GR   L LAK G  I    R    ++ + +E+       V+A     DV  +   +  +V    E  G ID L+NNAG+S      LDL+ +EW +I++ NL G + V++ V   M +  + G +INISS A    GQ    V  AY++SK  +  +T+ L  E+  H IRV+++ P    S+++
Sbjct:   12 TGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVK---ALGVKAAFAAADVK-DADQVNQAVAQVKEQLGDIDILINNAGIS-KFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIE-RKAGDIINISSTA----GQRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMS 193          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_BUCAI (3-oxoacyl-[acyl-carrier-protein] reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum GN=fabG PE=3 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 7.825e-16
Identity = 62/226 (27.43%), Postives = 112/226 (49.56%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITE---GLMKKDWLNNVASRTYPLRDFGTTDPALTSLV 670
            TGA+ G+G+     L K G +++  +   D +K + D +       V  +        N  +I   +Q  ++    ID L+NNAG+       +++   EW+ ++KTNL+  + + K V IR     ++G +I I S+ A +  +  G V Y++SK+GL    K L+LE+    I VN + PGL K+  TE    +  + +L+N+     P++ FG  +    +++
Sbjct:   11 TGANQGIGKAIAKKLIKKGIQVIGTSTTEDGVKRINDYLEGNGFGFVLNLK-------NIDSITEKIQEIYKKKHSIDILINNAGIKED-NLLVNMKSTEWDDVIKTNLSSVFHLVKSV-IRSMIKKRQGRIITIGSVIAYTGNK--GQVNYSASKSGLIGFHKSLALEVASKGITVNIVSPGLIKTNFTEKLNSIQYQKYLSNI-----PMKRFGQKEEVADAVI 220          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: PHBB_RALEH (Acetoacetyl-CoA reductase OS=Ralstonia eutropha (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 70/245 (28.57%), Postives = 120/245 (48.98%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAF----GRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT-FSL 721
            TG   G+G   C  LAK G R+VA        +    E  K       A+  +   S    A  +S + A++      G +D L+NNAG++  V     +T  +W+ ++ TNLT  + V+K V   M D    G ++NISS+    +GQ  G   Y+++KAGL+  T  L+ E+    + VN++ PG   +++ + + ++D L+ + + T P++  G  +  + S+  +L  + S    G  FSL
Sbjct:    9 TGGMGGIGTAICQRLAKDGFRVVAGCGPNSPRREKWLEQQK-------ALGFDFIASEGNVADWDSTKTAFDKVKSEVGEVDVLINNAGITRDVVFR-KMTRADWDAVIDTNLTSLFNVTKQVIDGMADRGW-GRIVNISSVNG-QKGQF-GQTNYSTAKAGLHGFTMALAQEVATKGVTVNTVSPGYIATDMVKAI-RQDVLDKIVA-TIPVKRLGLPE-EIASICAWLSSEESGFSTGADFSL 239          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: NODG_AZOBR (Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 69/247 (27.94%), Postives = 119/247 (48.18%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGTFSLLILGLRY 742
            TGA  GLG   C  LAK GC  + AA  +   +     + +Q     +    E DVS +  + +  V       G +D LVNNAG++   K    + + +W+ ++ TNL+  + V++ V  +M +    G +INISS+    +GQ  G   Y+++KAG+   TK L+ EL    + VN+I PG   +++   +  ++ +    + + P++  G  D  +   V YL  + +    G+   +  GL Y
Sbjct:    9 TGAMGGLGTAICQALAKDGC--IVAANCLPNFEPAAAWLGQQEALGFKFYVAEGDVS-DFESCKAMVAKIEADLGPVDILVNNAGITRD-KFFAKMDKAQWDAVIATNLSSLFNVTQQVSPKMAERGW-GRIINISSVNGV-KGQA-GQTNYSAAKAGVIGFTKALAAELATKGVTVNAIAPGYIGTDMVMAI--REDIRQAITDSVPMKRLGRPD-EIGGAVSYLASEIAGYVTGSTLNINGGLNY 245          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_RICPR (3-oxoacyl-[acyl-carrier-protein] reductase OS=Rickettsia prowazekii GN=fabG PE=1 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 58/196 (29.59%), Postives = 101/196 (51.53%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKK 589
            TGASSG+G      L K G +++ +    ++LKSL + +            +E+   AN     N +         +D LV NAG++    + + + +++++ ++  NL  ++++++    +M    + G +INISSI   +    PG   Y +SKAGL  MTK LS E+    I VN++ PG  KS++T+ L +K
Sbjct:   12 TGASSGIGSAIARLLHKLGSKVIISGSNEEKLKSLGNALKDN-------YTIEVCNLANKEECSNLISKT----SNLDILVCNAGITSDTLA-IRMKDQDFDKVIDINLKANFILNREAIKKMIQ-KRYGRIINISSIVGIAGN--PGQANYCASKAGLIGMTKSLSYEVATRGITVNAVAPGFIKSDMTDKLNEK 192          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: FABG_HAEIN (3-oxoacyl-[acyl-carrier-protein] reductase OS=Haemophilus influenzae GN=fabG PE=3 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 68/241 (28.22%), Postives = 116/241 (48.13%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGL---MKKDWLNNV-ASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TG++ G+GR    +L+  G  ++  A      +   + I+   G   + + + +    +  +IE  ++     FG ID LVNNAG++      + + +EEW  IM+TNLT  + +SK + +R     + G +INI S+  ++    PG   Y ++KAG+   +K L+ E+    I VN + PG   +++TE L    K   L+NV A R    +D       +   V +L  D +    GT
Sbjct:    9 TGSTRGIGRAIAEELSSKGAFVIGTATS----EKGAEAISAYLGDKGKGLVLNV---TDKESIETLLEQIKNDFGDIDILVNNAGITRD-NLLMRMKDEEWFDIMQTNLTSVYHLSKAM-LRSMMKKRFGRIINIGSVVGSTGN--PGQTNYCAAKAGVVGFSKSLAKEVAARGITVNVVAPGFIATDMTEVLTDEQKAGILSNVPAGRLGEAKD-------IAKAVAFLASDDAGYITGT 231          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: DCXR_BOVIN (L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 70/237 (29.54%), Postives = 112/237 (47.26%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAKAGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSEITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA  G+GR     L  AG R+VA +R    L SL  E        V  + V+L       A   + + A    G +D LVNNA V+  ++  L++T+E ++     NL     VS+ V   +      G ++N+SS  A+ RG L     Y S+K  L+ +TK +++ELG HKIRVN++ P +  + + +                PL  F   +  + +++ +L+ D S M  G+
Sbjct:   13 TGAGKGIGRSIVKALHAAGARVVAVSRTQADLDSLVREC-----PGVETVCVDL-------ADWEATEQALGGVGPVDLLVNNAAVA-FLQPFLEVTKEAYDMSFSVNLRAVIQVSQIVARGLIARGAPGVIVNVSS-QASQRG-LTNHSVYCSTKGALDTLTKVMAVELGPHKIRVNAVNPTVVMTPMGQAAWSDPQKAKAMLDRIPLGRFAEVENVVDTIL-FLLSDRSSMTTGS 233          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: BEND_ACIAD (1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter sp. (strain ADP1) GN=benD PE=3 SV=2)

HSP 1 Score: 84.3445 bits (207), Expect = 1.022e-15
Identity = 76/249 (30.52%), Postives = 124/249 (49.80%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAK-AGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKS------EITEGLMKKD--WLNNVASRTYP---LRDFGTTDPALTSLVRYLVHDSSDMYPGT 712
            TGA+ G+GR   L +A+  GC I+A   R D ++++  EI         A+AVE D+     A E  V  A   +GRID L+NN G +  +K   + +EEE    +  +L  +    + V   M   +Q+G+++N+SSIA     ++P    Y++SK G+NA+T  L+ E   H IRVN++  G  K+         + L K +  W+  V  +T     L  +G+ D  + + + +L  D S    G+
Sbjct:   15 TGAAQGIGRGVALRIAQEGGCLILAD--RSDLIQAVLAEIK---ALGALAIAVETDLETYAGA-ELVVSHAIAEYGRIDVLINNVGGAIWMKPFQEFSEEEIIQEVHRSLFPALWCCRAVLPEMLK-HQQGTIVNVSSIATRGIHRIP----YSASKGGVNALTASLAFEHAQHGIRVNAVATGGTKAPPRKIPRNAQPLSKSEQVWMQQVVDQTIDRSFLGRYGSIDEQVNA-ITFLASDESSYITGS 251          
BLAST of EY659229 vs. ExPASy Swiss-Prot
Match: YI13_SCHPO (Uncharacterized oxidoreductase C521.03 OS=Schizosaccharomyces pombe GN=SPAC521.03 PE=1 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.335e-15
Identity = 66/227 (29.07%), Postives = 114/227 (50.22%), Query Frame = 2
Query:    2 TGASSGLGREFCLDLAK-AGCRIVAAARRVDRLKSLCDEINKQSGSSVRAMAVELDVSANGAAIENSVQMAWEAFGRIDALVNNAGVSGAVKSPLDLTEEEWNHIMKTNLTGSWLVSKYVCIRMRDANQEGSVINISSIAATSRGQLPGGVAYASSKAGLNAMTKCLSLELGVHKIRVNSICPGLFKSE--ITEGLMKKDWLNNVASRTYPLRDFGTTDPALTSLVR 673
            TGASSG+G+    ++AK A  +++ AARR   ++ +  E+  +S   V  + ++LDVS +  +I   ++   + F  ID L+NNAG++      +DL  ++   ++ TN+ G   +++ V       N+ G ++N+ SIA   R    GG  Y S+K+ L   T  L  E    +IR+  + PGL ++E  +      K   +NV   + PL      +  L +L R
Sbjct:   12 TGASSGIGKSTAFEIAKVAKVKLILAARRFSTVEEIAKEL--ESKYEVSVLPLKLDVS-DLKSIPGVIESLPKEFADIDVLINNAGLALGTDKVIDLNIDDAVTMITTNVLGMMAMTRAVLPIFYSKNK-GDILNVGSIAG--RESYVGGSVYCSTKSALAQFTSALRKETIDTRIRIMEVDPGLVETEFSVVRFHGDKQKADNVYKNSEPLTPEDIAEVILFALTR 232          
The following BLAST results are available for this feature:
BLAST of EY659229 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 262
Match NameE-valueIdentityDescription
ACT3_STRCO4.587e-1633.33Putative ketoacyl reductase OS=Streptomyces coelic... [more]
YOXD_BACSU7.825e-1632.81Uncharacterized oxidoreductase yoxD OS=Bacillus su... [more]
FABG_BUCAI7.825e-1627.433-oxoacyl-[acyl-carrier-protein] reductase OS=Buch... [more]
PHBB_RALEH1.022e-1528.57Acetoacetyl-CoA reductase OS=Ralstonia eutropha (s... [more]
NODG_AZOBR1.022e-1527.94Nodulation protein G OS=Azospirillum brasilense GN... [more]
FABG_RICPR1.022e-1529.593-oxoacyl-[acyl-carrier-protein] reductase OS=Rick... [more]
FABG_HAEIN1.022e-1528.223-oxoacyl-[acyl-carrier-protein] reductase OS=Haem... [more]
DCXR_BOVIN1.022e-1529.54L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV... [more]
BEND_ACIAD1.022e-1530.521,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh... [more]
YI13_SCHPO1.335e-1529.07Uncharacterized oxidoreductase C521.03 OS=Schizosa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-G11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659229 ID=EY659229|Name=EY659229|organism=Citrus sinensis|type=EST|length=909bp
GACCGGGGCATCCTCCGGTTTAGGCCGAGAATTCTGTCTCGACTTGGCCA
AAGCTGGCTGCCGGATTGTCGCAGCGGCTCGCCGCGTCGACCGGCTCAAG
TCTCTCTGCGACGAGATCAATAAGCAGTCCGGGAGTAGTGTTAGAGCCAT
GGCCGTTGAGCTAGACGTCAGTGCCAATGGAGCCGCTATTGAGAATTCCG
TACAGATGGCTTGGGAAGCCTTCGGCCGAATCGATGCTTTGGTTAATAAT
GCCGGTGTATCAGGTGCTGTGAAGAGTCCATTAGATTTGACGGAGGAGGA
GTGGAATCATATTATGAAAACGAATTTGACAGGGTCTTGGTTGGTTTCGA
AATATGTATGCATCCGCATGCGTGACGCAAATCAGGAAGGATCAGTAATT
AATATATCTTCCATTGCTGCTACTAGCCGTGGACAGCTACCCGGAGGTGT
TGCATATGCTTCTTCAAAAGCAGGCCTAAATGCCATGACAAAGTGTCTGT
CATTGGAACTTGGGGTGCACAAAATCAGAGTCAATTCGATATGCCCTGGA
CTTTTCAAATCTGAAATCACCGAGGGGCTTATGAAAAAAGACTGGCTGAA
TAATGTGGCCTCAAGAACTTACCCTTTAAGAGATTTCGGCACCACCGACC
CCGCACTGACATCGCTTGTTCGGTACCTGGTTCATGACTCTTCTGATATG
TATCCGGGCACATTTTCATTGTTGATTCTGGGGCTACGCTACCANGTCTC
CCTATTTTCTCTTCCCCTTGACTTGTTCGGGAACTTTACAGTCAAATCTC
TTCTATTCTTTAAATCCTTGCTGCAATATATTCTAACACANGAGCATAAA
TGGGCCTGTGCTATTGGGGAAGTACTGCGGTATACTCATTAAAAAAAAAA
AAAAAGAGG
back to top