EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_MESSB (60 kDa chaperonin 1 OS=Mesorhizobium sp. (strain BNC1) GN=groL1 PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.512e-80
Identity = 152/269 (56.51%), Postives = 202/269 (75.09%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +++  GVN LAD V VTLGPKGRNVVL+  +GAP+I  DGVTVAKE+ELED  EN+GA++VR+ A+KTND+AGDGTTT+ VLAQ ++ EG K VAAG NP+ + RG++     +V  L + +K+++ SE +A V  +SA    E+G MIAEAM KVG +GV+T+EE K+AE  L VVEGMQFDRGY+SPYF+T+ EKM  E E+  +LL +KK++N + ++ VLE  ++   P+LIIAED+E EAL TLVVNKLRG L+ AA+K  G
Sbjct:   12 ARERMLRGVNILADAVKVTLGPKGRNVVLDKSFGAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVQEGAKAVAAGMNPMDLKRGVDLAVAEVVDYLAKAAKKIKTSEEVAQVGTISANGEKEIGQMIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFITNPEKMVAELEDVYILLHEKKLSNLQAMLPVLEAVVQSGRPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_WOLSU (60 kDa chaperonin OS=Wolinella succinogenes GN=groL PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 148/269 (55.02%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  KL  GV +LAD V VT+GP+GRNV+++  +GAP I  DGV+VAKE+EL D + N+GA+LV++ A+KT D AGDGTTT+ VLA G+  EG++ + AGANP+ + RG++K + A++ ELK++SK+V D  E+A VA +SA ++  +G++IAEAM KVG+ GV+T+EE K   + L VVEGMQFDRGY+SPYFVT+S+KM    EN  +LL DKKIT+ +D++ +LE  ++   P+LI+AEDIE EAL TLVVNKLRG L  AA+K  G
Sbjct:   12 ARNKLYEGVRQLADAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEIELADAISNMGAQLVKEVASKTADAAGDGTTTATVLAHGIFKEGLRNITAGANPIEVKRGMDKATAAIIDELKKLSKKVNDKKEIAQVATISANSDENIGSLIAEAMEKVGKDGVITVEEAKGINDELNVVEGMQFDRGYLSPYFVTNSDKMEAVLENPYILLTDKKITSMKDILPLLEGTMKSGRPLLIVAEDIEGEALTTLVVNKLRGVLNVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_THET8 (60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 151/268 (56.34%), Postives = 202/268 (75.37%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVN +A+ V VTLGP+GRNVVLE K+G+P I  DGVTVAKEVELED +ENIGA+L+++ A+KTND+AGDGTTT+ VLAQ ++ EG+K VAAGANP+ + RGIEK  +A V ++K ++  VED +  +  A  + N+ EVG +IA+AM KVG++G++T+EE KS E  L  VEG QFD+GYISPYFVT+ E M    E+  +L+V+KK++N R+L+ +LE   +   P+LIIAED+E EAL TLVVNKLRG L  AA+K  G
Sbjct:   11 ARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIEKAVEAAVEKIKALAIPVEDRKAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVAQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_THET2 (60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 151/268 (56.34%), Postives = 202/268 (75.37%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVN +A+ V VTLGP+GRNVVLE K+G+P I  DGVTVAKEVELED +ENIGA+L+++ A+KTND+AGDGTTT+ VLAQ ++ EG+K VAAGANP+ + RGIEK  +A V ++K ++  VED +  +  A  + N+ EVG +IA+AM KVG++G++T+EE KS E  L  VEG QFD+GYISPYFVT+ E M    E+  +L+V+KK++N R+L+ +LE   +   P+LIIAED+E EAL TLVVNKLRG L  AA+K  G
Sbjct:   11 ARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVELEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIEKAVEAAVEKIKALAIPVEDRKAIEEVATISANDPEVGKLIADAMEKVGKEGIITVEESKSLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVAQTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_DICTD (60 kDa chaperonin OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=groL PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 150/269 (55.76%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVE-DSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A   L  G++ +AD V +TLGPKGRNVVLE K+GAP I NDGVT+AKE++LEDP EN+GA+LV++ A+KTND+AGDGTTT+ VLAQ L+ EG+K V AGANP+ + RGIEK  + +V ELK+++K VE   ++A VAA+SA N+ E+GN+IAEAM KVG+ GV+T+EE +     L +VEGMQFDRGY+S Y +TD E+M    E   +L+ DKKI+   +++ +LE  ++   P++IIAED+E EAL TLVVNKLRG L++ A+K  G
Sbjct:   12 ARTALIKGLDTVADTVKITLGPKGRNVVLEKKFGAPVITNDGVTIAKEIDLEDPFENMGAQLVKEVASKTNDVAGDGTTTATVLAQALVHEGMKHVVAGANPMYVKRGIEKAVEKVVEELKKIAKPVETKQDIAHVAAISANNDEEIGNLIAEAMDKVGKDGVITVEESQGITTTLELVEGMQFDRGYLSAYMITDPERMEAVLEEPYILITDKKISAVSEILPILERVVQTGKPLVIIAEDVEGEALATLVVNKLRGVLQSLAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_DESVV (60 kDa chaperonin OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=groL PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 151/269 (56.13%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +KL  GV+KLA+ V VTLGPKGRNVV+E  +G+P I  DGV+VAKE+ELED  EN+GA++V++ A+KT+D+AGDGTTT+ +LAQ +  EGVK+VAAG NP+ I RG++K  ++LV EL  ++K   D  E+A V  +SA ++  +GN+IAEAMSKVG++GV+T+EE K  E  L VVEGMQFDRGY+SPYFVTD EKM  E +   +L  +KKI+  +D++ VLE   +   P++IIAED++ EAL TLVVNKLRGAL+  A+K  G
Sbjct:   12 AREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIYREGVKLVAAGRNPMAIKRGVDKAVESLVRELGNLAKPTRDQKEIAQVGTISANSDSTIGNIIAEAMSKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDPEKMVCELDEPFILCNEKKISTMKDMLPVLEQVAKMQRPLVIIAEDVDGEALATLVVNKLRGALQVVAIKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_DESVH (60 kDa chaperonin OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=groL PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 151/269 (56.13%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A +KL  GV+KLA+ V VTLGPKGRNVV+E  +G+P I  DGV+VAKE+ELED  EN+GA++V++ A+KT+D+AGDGTTT+ +LAQ +  EGVK+VAAG NP+ I RG++K  ++LV EL  ++K   D  E+A V  +SA ++  +GN+IAEAMSKVG++GV+T+EE K  E  L VVEGMQFDRGY+SPYFVTD EKM  E +   +L  +KKI+  +D++ VLE   +   P++IIAED++ EAL TLVVNKLRGAL+  A+K  G
Sbjct:   12 AREKLSRGVDKLANAVKVTLGPKGRNVVIEKSFGSPVITKDGVSVAKEIELEDKFENMGAQMVKEVASKTSDIAGDGTTTATILAQAIYREGVKLVAAGRNPMAIKRGVDKAVESLVRELGNLAKPTRDQKEIAQVGTISANSDSTIGNIIAEAMSKVGKEGVITVEEAKGLETTLEVVEGMQFDRGYLSPYFVTDPEKMVCELDEPFILCNEKKISTMKDMLPVLEQVAKMQRPLVIIAEDVDGEALATLVVNKLRGALQVVAIKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_PROMM (60 kDa chaperonin 1 OS=Prochlorococcus marinus (strain MIT 9313) GN=groL1 PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 3.281e-80
Identity = 149/261 (57.09%), Postives = 196/261 (75.10%), Query Frame = 3
Query:   42 LQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            L+ GVN LAD V VT+GP+GRNVVLE K+GAP IVNDGVT+AKE+EL+DP EN+GAKL++Q A+KT D AGDGTTT+ VLAQ ++ EG++ VAAGA+P+ + RG+EK    LV EL Q+S+ V  + +  VA VS+G + EVG M++EAM KV   GV+T+EE KS    L V EGM FDRGY SPYFVTD+++   E+EN  LLL D+KI++  DL+ +LE   +   P++IIAE++E EAL TLVVNK RG L+ AA++
Sbjct:   15 LERGVNSLADAVRVTIGPRGRNVVLEKKFGAPDIVNDGVTIAKEIELDDPFENLGAKLIQQVASKTKDKAGDGTTTATVLAQAMVHEGLRNVAAGASPIELRRGMEKAVAQLVEELAQLSQSVGGNAIHQVATVSSGGDQEVGRMVSEAMDKVSADGVITVEESKSLATELEVTEGMAFDRGYSSPYFVTDADRQICEFENALLLLTDRKISSVSDLVPILESLQKSGSPLVIIAEEVEGEALATLVVNKNRGVLQVAAVR 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_PSEU5 (60 kDa chaperonin OS=Pseudomonas stutzeri (strain A1501) GN=groL PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.285e-80
Identity = 153/269 (56.88%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A KK+  GVN LAD V  TLGPKGRNVVLE  +GAP I  DGV+VAKE+EL+D  EN+GA+LV+  A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K + A+V+ELKQ++K   DS+ +A V  +SA ++  +G +IAEAM +VG++GV+T+EEG   EN L VVEGMQFDRGY+SPYF+   + M  E +N  LLLVDKKI+N R+L+ VLE   +   P+LI+AED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARKKMLVGVNVLADAVKATLGPKGRNVVLEKSFGAPTITKDGVSVAKEIELKDRFENMGAQLVKDVASKANDEAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATIAIVAELKQLAKPCTDSKAIAQVGTISANSDESIGQIIAEAMERVGKEGVITVEEGSGFENELSVVEGMQFDRGYLSPYFINKPDTMVAELDNPLLLLVDKKISNIRELLPVLEGVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_PSEPW (60 kDa chaperonin OS=Pseudomonas putida (strain W619) GN=groL PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 4.285e-80
Identity = 154/269 (57.25%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A KK+  GVN LAD V  TLGPKGRNVVL   +GAP I  DGV+VAKE+EL+D  EN+GA+LV++ A+K ND AGDGTTT+ VLAQ ++ EG+K VAAG NP+ + RGI+K + A+V+ELK +SK   DS+ +A V  +SA ++  +G +IAEAM KVG++GV+T+EEG   EN L VVEGMQFDRGY+SPYFV   + M  E E+  LLLVDKKI+N R+L+ VLE   +   P+LI+AED+E EAL TLVVN +RG ++ AA+K  G
Sbjct:   12 ARKKMLVGVNVLADAVKATLGPKGRNVVLAKSFGAPTITKDGVSVAKEIELKDAFENMGAQLVKEVASKANDAAGDGTTTATVLAQAIVNEGLKAVAAGMNPMDLKRGIDKATAAVVAELKNLSKPCADSKAIAQVGTISANSDNSIGEIIAEAMEKVGKEGVITVEEGSGLENELSVVEGMQFDRGYLSPYFVNKPDTMVAELESPLLLLVDKKISNIRELLPVLEAVAKAGRPLLIVAEDVEGEALATLVVNNMRGIVKVAAVKAPG 280          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH601_MESSB2.512e-8056.5160 kDa chaperonin 1 OS=Mesorhizobium sp. (strain B... [more]
CH60_WOLSU3.281e-8055.0260 kDa chaperonin OS=Wolinella succinogenes GN=gro... [more]
CH60_THET83.281e-8056.3460 kDa chaperonin OS=Thermus thermophilus (strain ... [more]
CH60_THET23.281e-8056.3460 kDa chaperonin OS=Thermus thermophilus (strain ... [more]
CH60_DICTD3.281e-8055.7660 kDa chaperonin OS=Dictyoglomus turgidum (strain... [more]
CH60_DESVV3.281e-8056.1360 kDa chaperonin OS=Desulfovibrio vulgaris subsp.... [more]
CH60_DESVH3.281e-8056.1360 kDa chaperonin OS=Desulfovibrio vulgaris (strai... [more]
CH601_PROMM3.281e-8057.0960 kDa chaperonin 1 OS=Prochlorococcus marinus (st... [more]
CH60_PSEU54.285e-8056.8860 kDa chaperonin OS=Pseudomonas stutzeri (strain ... [more]
CH60_PSEPW4.285e-8057.2560 kDa chaperonin OS=Pseudomonas putida (strain W6... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top