EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_FUSNN (60 kDa chaperonin OS=Fusobacterium nucleatum subsp. nucleatum GN=groL PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 5.408e-83
Identity = 152/266 (57.14%), Postives = 208/266 (78.20%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            A KKL+ GVN LAD V VTLGP+GRNVVLE  YGAP I NDGVT+AKE+ELEDP EN+GA LV++ A K+ND+AGDGTTT+ +LAQ ++ EG+K+++AGANP+ + +GIE  +K  V  LK  +K++E +E ++ VA++SAG+  E+G +IA+AM+KVG  GV+T+EE KS E  L +VEGMQFD+GY+SPY VTDSE+M  E +N  +LL DKKI++ ++L+ +LE  ++ + P+LI+A+DIE EAL TLV+NKLRG L   A+K
Sbjct:   11 ARKKLEIGVNTLADAVKVTLGPRGRNVVLEKSYGAPLITNDGVTIAKEIELEDPFENMGAALVKEVAIKSNDVAGDGTTTATILAQAIVKEGLKMLSAGANPIFLKKGIELAAKEAVEVLKDKAKKIESNEEISQVASISAGDE-EIGKLIAQAMAKVGETGVITVEEAKSLETTLEIVEGMQFDKGYVSPYMVTDSERMTAELDNPLILLTDKKISSMKELLPLLEQTVQMSKPVLIVADDIEGEALTTLVINKLRGTLNVVAVK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CYAPA (60 kDa chaperonin, cyanelle OS=Cyanophora paradoxa GN=groL-A PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.063e-83
Identity = 156/269 (57.99%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND+AGDGTTT+ VLA  ++ EG++ VAAGANP+ I RGI++ ++ +V  +   +K VEDS  +  VA++SAGN+ EVG MIA+A+ KVG++GV++LEEGKS    L + EGM+FD+GYISPYFVTD E+M V  ++   L+ DKKIT  +DL+ +LE   R   P+ IIAEDIE+EAL TLVVNKLRG L  +A+K  G
Sbjct:   11 ARRALEKGMDILAEAVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDHIENTGVALIRQAASKTNDVAGDGTTTATVLAYAMVKEGMRNVAAGANPMAIKRGIDRATQKVVETIAAHAKPVEDSRAITQVASISAGNDDEVGKMIADAIEKVGKEGVISLEEGKSTTTELEITEGMRFDKGYISPYFVTDPERMEVIQKDAMFLITDKKITLVQDLVPILEQVARARKPLFIIAEDIEKEALATLVVNKLRGNLNVSAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNP6 (60 kDa chaperonin 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=groL2 PE=3 SV=1)

HSP 1 Score: 307.375 bits (786), Expect = 7.063e-83
Identity = 156/262 (59.54%), Postives = 201/262 (76.72%), Query Frame = 3
Query:   42 LQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            L+ GVN LA+ V VTLGP+GRNV+LE K+GAP+I+NDGV++AKE+ELEDP EN GA+LV++ AAKT ++AGDGTTT+ VLAQ ++ EG+  VAAGANP+++ RGIEK    LV  +   ++ V D + +  +AAVSAGN+ EVG MIA+A++KV + GV+T+EE KS    L VVEGMQFDRGY+SPYFVTD ++  VEY+N  +LL DKKI + +DL+ VLED  R   P+LIIAEDIE EAL TLVVNK RG L   A+K
Sbjct:   15 LERGVNALANAVKVTLGPRGRNVLLEKKFGAPEIINDGVSIAKEIELEDPHENAGARLVQEVAAKTKEIAGDGTTTATVLAQAIVREGLTNVAAGANPIVLRRGIEKAVATLVEAIAAKAQPVADEAAIRSIAAVSAGNDDEVGQMIADAVAKVTKDGVITVEESKSLATELEVVEGMQFDRGYLSPYFVTDQDRQVVEYDNPLILLTDKKIASIQDLVPVLEDVARAGRPLLIIAEDIEGEALATLVVNKARGVLNTVAVK 276          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNPX (60 kDa chaperonin 1 OS=Synechococcus sp. (strain WH8102) GN=groL1 PE=3 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 9.225e-83
Identity = 156/269 (57.99%), Postives = 204/269 (75.84%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G++ VAAGAN + + +GI+K S  LVS++K+ +K + DS  +A V  +SAGN+ EVG MIA+AM KVG++GV++LEEGKS E  L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   R   P++IIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGIDILAESVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGIDKASDFLVSKIKEQAKPIADSNAIAQVGTISAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMETELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQIARTGKPLMIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOSF (60 kDa chaperonin OS=Geobacter sp. (strain FRC-32) GN=groL PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 1.205e-82
Identity = 156/262 (59.54%), Postives = 199/262 (75.95%), Query Frame = 3
Query:   51 GVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            GVN LAD V VTLGPKGRNVV+E  +GAP I  DGVTVAKE+ELED  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQ +  +G K+VAAG NP+ I RGI+K  + LV+ELK +SK ++D  E+A V  +SA N+  +G++IAEAM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD E+M    EN  +L+ DKKI+N +DL+ VLE   +   P++IIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   18 GVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGIDKAVETLVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEANLENANILIHDKKISNMKDLLPVLEQTAKSGRPLVIIAEDIEGEALATLVVNKLRGVLNICAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOKA (60 kDa chaperonin OS=Geobacillus kaustophilus GN=groL PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.573e-82
Identity = 161/269 (59.85%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K VAAGANP+ I RGIEK     V ELK +SK ++  E +A VAA+SA +  EVG +IAEAM +VG  GV+TLEE K     L VVEGMQFDRGY+SPY +TD+EKM    EN  +L+ DKK+++ ++L+ VLE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDIAGDGTTTATVLAQAMIREGLKNVAAGANPMGIRRGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADE-EVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKVSSIQELLPVLEQVVQQGRPLLIIAEDVEGEALATLVVNKLRGTFNAVAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GALSU (60 kDa chaperonin, chloroplastic OS=Galdieria sulphuraria GN=groL PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.573e-82
Identity = 152/270 (56.30%), Postives = 209/270 (77.41%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNA-RDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A K L+ G++ LA+ V VTLGPKGRNVV+E KYG P+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND+AGDGTTTS VLA  ++ +G++ VAAGANP+ + RGI+K ++ +++++ + S+ VED++ +  VA +S+GN+  +G MIA+A+ KVGR+GV+++EEGKS    L + EGM+F+RGYISPYFVTDS++M V  EN  +L+ DKKIT   +DL+ VLE   +   P+LIIAEDIE+EAL TL+VNKLRG L   A+K  G
Sbjct:   11 ARKALEKGIDILAEAVSVTLGPKGRNVVIEKKYGPPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDVAGDGTTTSTVLAHAIVKQGMRNVAAGANPIALKRGIDKATQFIINKISEYSRPVEDNKAITQVATISSGNDENIGKMIADAIEKVGREGVISIEEGKSTTTELEIKEGMKFERGYISPYFVTDSDRMEVVQENASVLITDKKITLVQQDLLPVLEQIAKTNKPLLIIAEDIEKEALATLIVNKLRGILNVVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_FUSNP (60 kDa chaperonin OS=Fusobacterium nucleatum subsp. polymorphum GN=groL PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.573e-82
Identity = 151/266 (56.77%), Postives = 207/266 (77.82%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            A KKL+ GVN LAD V VTLGP+GRNVVLE  YGAP I NDGVT+AKE+ELEDP EN+GA LV++ A K+ND+AGDGTTT+ +LAQ ++ EG+K+++AGANP+ + +GIE  +K  +  LK  +K++E +E ++ VA++SAG+  E+G +IA+AM+KVG  GV+T+EE KS E  L  VEGMQFD+GY+SPY VTDSE+M  E +N  +LL DKKI++ ++L+ +LE  ++ + P+LI+A+DIE EAL TLV+NKLRG L   A+K
Sbjct:   11 ARKKLEIGVNTLADAVKVTLGPRGRNVVLEKSYGAPLITNDGVTIAKEIELEDPFENMGAALVKEVAIKSNDVAGDGTTTATILAQAIVKEGLKMLSAGANPIFLKKGIELAAKEAIDVLKDKAKKIESNEEISQVASISAGDE-EIGKLIAQAMAKVGETGVITVEEAKSLETTLETVEGMQFDKGYVSPYMVTDSERMTAELDNPLILLTDKKISSMKELLPLLEQTVQMSKPVLIVADDIEGEALTTLVINKLRGTLNVVAVK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNS9 (60 kDa chaperonin 1 OS=Synechococcus sp. (strain CC9902) GN=groL1 PE=3 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 1.573e-82
Identity = 156/269 (57.99%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+G+P+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G++ VAAGAN + + +GI+K S  LV ++K M+K + DS  +A V  +SAGN+ EVG MIA+AM KVG++GV++LEEGKS E  L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   R   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGIDILAESVAVTLGPKGRNVVLEKKFGSPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGIDKASDFLVGKIKDMAKPIADSNAIAQVGTISAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMETELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQIARTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOSM (60 kDa chaperonin OS=Geobacter sp. (strain M21) GN=groL PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.055e-82
Identity = 156/262 (59.54%), Postives = 199/262 (75.95%), Query Frame = 3
Query:   51 GVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            GVN LAD V VTLGPKGRNVV+E  YGAP I  DGVTVAKE+ELED  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQ +  +G K+VAAG NP+ I RG+++  +ALV+ELK +SK ++D  E+A V  +SA N+  +G++IAEAM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD E+M    +N  +L+ DKKI N +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   19 GVNTLADAVKVTLGPKGRNVVIEKSYGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDNVAILIHDKKIANMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPG 280          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_FUSNN5.408e-8357.1460 kDa chaperonin OS=Fusobacterium nucleatum subsp... [more]
CH60_CYAPA7.063e-8357.9960 kDa chaperonin, cyanelle OS=Cyanophora paradoxa... [more]
CH602_SYNP67.063e-8359.5460 kDa chaperonin 2 OS=Synechococcus sp. (strain A... [more]
CH601_SYNPX9.225e-8357.9960 kDa chaperonin 1 OS=Synechococcus sp. (strain W... [more]
CH60_GEOSF1.205e-8259.5460 kDa chaperonin OS=Geobacter sp. (strain FRC-32)... [more]
CH60_GEOKA1.573e-8259.8560 kDa chaperonin OS=Geobacillus kaustophilus GN=g... [more]
CH60_GALSU1.573e-8256.3060 kDa chaperonin, chloroplastic OS=Galdieria sulp... [more]
CH60_FUSNP1.573e-8256.7760 kDa chaperonin OS=Fusobacterium nucleatum subsp... [more]
CH601_SYNS91.573e-8257.9960 kDa chaperonin 1 OS=Synechococcus sp. (strain C... [more]
CH60_GEOSM2.055e-8259.5460 kDa chaperonin OS=Geobacter sp. (strain M21) GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top