EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOBB (60 kDa chaperonin OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=groL PE=3 SV=1)

HSP 1 Score: 305.834 bits (782), Expect = 2.055e-82
Identity = 156/262 (59.54%), Postives = 199/262 (75.95%), Query Frame = 3
Query:   51 GVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            GVN LAD V VTLGPKGRNVV+E  YGAP I  DGVTVAKE+ELED  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQ +  +G K+VAAG NP+ I RG+++  +ALV+ELK +SK ++D  E+A V  +SA N+  +G++IAEAM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD E+M    +N  +L+ DKKI N +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   19 GVNTLADAVKVTLGPKGRNVVIEKSYGAPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGLDQAVEALVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEAAMDNVAILIHDKKIANMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNVCAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_METVS (60 kDa chaperonin OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=groL PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.684e-82
Identity = 154/266 (57.89%), Postives = 205/266 (77.07%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVE-DSELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALK 824
            A KKL+NGV+ L++ V VTLGPKGRNVV+E  YG+P I NDGVT+AKE+ELEDP EN+GA+L+++ A K ND+AGDGTTT+ VLAQ ++ EG+K++ AG+NPV + RGIEK +K  VS L+  SK++  +SE+A VA++SAG+  E+GN+IA+AM KVG  GV+T+EE KS E  L VVEGMQFD+GYIS Y VTD E+M  E ++  +L+ DKKI+N ++++ VLE   R + P+LIIAEDIE + L TLVVNKLRG L    +K
Sbjct:   11 ARKKLENGVDVLSNTVKVTLGPKGRNVVIEKSYGSPLITNDGVTIAKEIELEDPFENMGAQLIKEVATKANDVAGDGTTTATVLAQAMVKEGLKMITAGSNPVFVKRGIEKATKKAVSILETKSKKIAGNSEIAQVASISAGDE-EIGNLIAKAMEKVGENGVITVEEAKSLETTLEVVEGMQFDKGYISSYLVTDPERMTAELDDPYILITDKKISNMKEILPVLEATARSSRPLLIIAEDIEGDVLTTLVVNKLRGTLNVVGVK 275          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOUR (60 kDa chaperonin OS=Geobacter uraniireducens (strain Rf4) GN=groL PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.684e-82
Identity = 155/262 (59.16%), Postives = 199/262 (75.95%), Query Frame = 3
Query:   51 GVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            GVN LAD V VTLGPKGRNVV+E  +GAP I  DGVTVAKE+EL+D  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQ +  +G K+VAAG NP+ I RGI+K  + LV+ELK +SK ++D  E+A V  +SA N+  +G++IAEAM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD E+M    EN  +L+ DKKI+N +DL+ VLE   +   P++IIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   18 GVNTLADAVKVTLGPKGRNVVIEKSFGAPLITKDGVTVAKEIELDDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGAKLVAAGHNPMEIKRGIDKAVETLVAELKNISKPIKDHKEIAQVGTISANNDKTIGDIIAEAMEKVGKEGVITVEEAKAMETTLETVEGMQFDRGYLSPYFVTDPERMEATLENANILIHDKKISNMKDLLPVLEQTAKSGRPLIIIAEDIEGEALATLVVNKLRGVLNICAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOSW (60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1)

HSP 1 Score: 305.449 bits (781), Expect = 2.684e-82
Identity = 160/269 (59.48%), Postives = 200/269 (74.35%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K V AGANP+ I +GIEK     V ELK +SK ++  E +A VAA+SA +  EVG +IAEAM +VG  GV+TLEE K     L VVEGMQFDRGY+SPY +TD+EKM    EN  +L+ DKKI+N +D++ +LE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIKGKESIAQVAAISAADE-EVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CALS8 (60 kDa chaperonin OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903) GN=groL PE=3 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 3.505e-82
Identity = 154/269 (57.25%), Postives = 208/269 (77.32%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ GVNKLAD V VTLGPKGRNVVLE K+G+P+IVNDGVT+AKE+ELEDP EN+GA++VR+ A+KTND+AGDGTTT+ VLAQ +I EG+K +AAGANP+++ RGI+K    +V E+K+MSK+V   E +  VA++SAG+  E+G ++A+AM KV   GV+T+EE K+ E  L +VEGMQFDRGYIS Y VTD+E+M    ++  +L+ DKKI+  +D++ +LE  ++    +LIIAED+E EAL TLVVNKLRG L+  A+K  G
Sbjct:   12 ARRALERGVNKLADTVKVTLGPKGRNVVLEKKFGSPQIVNDGVTIAKEIELEDPFENMGAQIVREVASKTNDIAGDGTTTATVLAQAMIREGLKNIAAGANPMILRRGIQKAVDVVVDEIKKMSKKVRGKEDITYVASISAGDE-EIGKLVADAMEKVTNDGVITVEESKTTETTLEIVEGMQFDRGYISAYMVTDTERMEAVLDDPYILITDKKISTIQDILPLLEQIVQQGKKLLIIAEDVEGEALATLVVNKLRGTLQCVAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIGO (60 kDa chaperonin OS=Neisseria gonorrhoeae GN=groL PE=1 SV=3)

HSP 1 Score: 304.294 bits (778), Expect = 5.979e-82
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGIKAVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGVLKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_BACTR (60 kDa chaperonin OS=Bacillus thermoglucosidasius GN=groL PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 5.979e-82
Identity = 160/269 (59.48%), Postives = 199/269 (73.98%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K V AGANP+ I +GIEK     V ELK +SK ++  E +A VAA+SA +  EVG +IAEAM +VG  GV+TLEE K     L VVEGMQFDRGY SPY +TD+EKM    EN  +L+ DKKI+N +D++ +LE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIQGKESIAQVAAISAADE-EVGQLIAEAMERVGNDGVITLEESKGFTTELDVVEGMQFDRGYASPYMITDTEKMEAVLENPYILITDKKISNIQDILPILEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_SYNS3 (60 kDa chaperonin 2 OS=Synechococcus sp. (strain CC9311) GN=groL2 PE=3 SV=1)

HSP 1 Score: 304.294 bits (778), Expect = 5.979e-82
Identity = 155/269 (57.62%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ LA+ V VTLGPKGRNVVLE K+GAP+I+NDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++  G++ VAAGAN + + +GI+K S  LV ++++ +K + DS  +A V  +SAGN+ EVG MIA+AM KVG++GV++LEEGKS E  L V EGM+FD+GYISPYF TD+E+M    +   +LL DKKI   +DL+ VLE   R   P+LIIAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIELEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKAGLRNVAAGANAITLKKGIDKASDFLVGKIQENAKPIADSNAIAQVGTISAGNDEEVGKMIADAMDKVGKEGVISLEEGKSMETELEVTEGMRFDKGYISPYFATDTERMEAVLDEPYILLTDKKIGLVQDLVPVLEQIARTGKPLLIIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_MAGSM (60 kDa chaperonin OS=Magnetococcus sp. (strain MC-1) GN=groL PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 7.809e-82
Identity = 156/269 (57.99%), Postives = 211/269 (78.44%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  K+ NGVN LA+ V VTLGPKGRNVVL+  +GAP++  DGV+VAKE+ELED  EN+GA++VR+ ++KT D+AGDGTTT+ VLAQ +I EG+K VAAG NP+ + RGI+   +A+V  LK +S+EV +S E+A V A+SA ++  VG+MIAEAM KVG++GV+T+EE K  E  L VVEGMQFDRGY+SPYFVT+++KM V+ EN  +LLV+KKI+N + ++ +LE A++ + P++IIAED+E EAL TLVVNKLRG L+  A+K  G
Sbjct:   12 ARAKMLNGVNILANAVKVTLGPKGRNVVLDKSWGAPRMTKDGVSVAKEIELEDKFENMGAQMVREVSSKTADVAGDGTTTATVLAQAIIREGMKAVAAGMNPMDLKRGIDLAVEAVVVGLKGISREVANSQEIAQVGAISANSDKVVGDMIAEAMDKVGKEGVITVEEAKGLETTLDVVEGMQFDRGYLSPYFVTNADKMLVQMENPLILLVEKKISNLQQILQILEGAVQSSRPLMIIAEDVEGEALATLVVNKLRGGLKVCAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CAMJJ (60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=groL PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 7.809e-82
Identity = 154/269 (57.25%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  KL  GV KL D V VT+GP+GRNV+++  +GAP I  DGV+VAKEVEL+D +EN+GA LVR+ A+KT D AGDGTTT+ VLA  +  EG++ + AGANP+ + RG++K  +A+V+ELK++S+EV+D  E+A VA +SA ++ ++GN+IA+AM KVG+ GV+T+EE KS  + L VVEGMQFDRGY+SPYF+T++EKM VE  +  +LL DKKITN +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L  +A+K  G
Sbjct:   11 ARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPG 279          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_GEOBB2.055e-8259.5460 kDa chaperonin OS=Geobacter bemidjiensis (strai... [more]
CH60_METVS2.684e-8257.8960 kDa chaperonin OS=Methanococcus vannielii (stra... [more]
CH60_GEOUR2.684e-8259.1660 kDa chaperonin OS=Geobacter uraniireducens (str... [more]
CH60_GEOSW2.684e-8259.4860 kDa chaperonin OS=Geobacillus sp. (strain WCH70... [more]
CH60_CALS83.505e-8257.2560 kDa chaperonin OS=Caldicellulosiruptor saccharo... [more]
CH60_NEIGO5.979e-8257.6860 kDa chaperonin OS=Neisseria gonorrhoeae GN=groL... [more]
CH60_BACTR5.979e-8259.4860 kDa chaperonin OS=Bacillus thermoglucosidasius ... [more]
CH602_SYNS35.979e-8257.6260 kDa chaperonin 2 OS=Synechococcus sp. (strain C... [more]
CH60_MAGSM7.809e-8257.9960 kDa chaperonin OS=Magnetococcus sp. (strain MC-... [more]
CH60_CAMJJ7.809e-8257.2560 kDa chaperonin OS=Campylobacter jejuni subsp. j... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top