EY659218

Overview
NameEY659218
Unique NameEY659218
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length881
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2470 contig Csv1_Contig2470:274..1154. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_CAMJE (60 kDa chaperonin OS=Campylobacter jejuni GN=groL PE=1 SV=2)

HSP 1 Score: 303.908 bits (777), Expect = 7.809e-82
Identity = 154/269 (57.25%), Postives = 206/269 (76.58%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A  KL  GV KL D V VT+GP+GRNV+++  +GAP I  DGV+VAKEVEL+D +EN+GA LVR+ A+KT D AGDGTTT+ VLA  +  EG++ + AGANP+ + RG++K  +A+V+ELK++S+EV+D  E+A VA +SA ++ ++GN+IA+AM KVG+ GV+T+EE KS  + L VVEGMQFDRGY+SPYF+T++EKM VE  +  +LL DKKITN +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L  +A+K  G
Sbjct:   11 ARNKLYEGVKKLNDAVKVTMGPRGRNVLIQKSFGAPSITKDGVSVAKEVELKDSLENMGASLVREVASKTADQAGDGTTTATVLAHAIFKEGLRNITAGANPIEVKRGMDKACEAIVAELKKLSREVKDKKEIAQVATISANSDEKIGNLIADAMEKVGKDGVITVEEAKSINDELNVVEGMQFDRGYLSPYFITNAEKMTVELSSPYILLFDKKITNLKDLLPVLEQIQKTGKPLLIIAEDIEGEALATLVVNKLRGVLNISAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_ANOFW (60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 7.809e-82
Identity = 159/269 (59.11%), Postives = 201/269 (74.72%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDSE-LADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + +  GV+KLAD V VTLGPKGRNVVLE K+G+P I NDGVT+AKE+ELEDP EN+GAKLV + A+KTND+AGDGTTT+ VLAQ +I EG+K V AGANP+ I +GIEK     V ELK +SK +E  + +A VAA+SA +  EVG +IAEAM +VG+ GV+TLEE K     L VVEGMQFDRGY+SPY +TDS+KM    EN  +L+ DKK+++ ++L+ VLE  ++   P+LIIAED+E EAL TLVVNKLRG     A+K  G
Sbjct:   11 ARRAMLRGVDKLADAVKVTLGPKGRNVVLEKKFGSPLITNDGVTIAKEIELEDPFENMGAKLVAEVASKTNDVAGDGTTTATVLAQAMIREGLKNVTAGANPMGIRKGIEKAVAVAVEELKAISKPIEGKDSIAQVAAISAADE-EVGQLIAEAMERVGKDGVITLEESKGFTTELDVVEGMQFDRGYVSPYMITDSDKMEAVLENPYILITDKKVSSIQELLPVLEQVVQQGKPLLIIAEDVEGEALATLVVNKLRGTFTAVAVKAPG 278          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH602_ACAM1 (60 kDa chaperonin 2 OS=Acaryochloris marina (strain MBIC 11017) GN=groL2 PE=3 SV=1)

HSP 1 Score: 303.908 bits (777), Expect = 7.809e-82
Identity = 156/269 (57.99%), Postives = 202/269 (75.09%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L+ G++ L + V VTLGPKGRNVVLE K+GAP+IVNDGVT+AKE+ELED +EN G  L+RQAA+KTND AGDGTTT+ VLA  ++ EG++ V AGAN + + RGIEK +  LV ++ + ++ VEDS  +A V  +SAGN+ EVG MIA AM KVG++GV++LEEGKS    L V EGM+F++GYISPYF TD+E+M    +   +LL DKKIT  +DL+ VLE A R   P+L+IAEDIE+EAL TLVVN+LRG L  AA+K  G
Sbjct:   11 ARRALEKGMDILCESVAVTLGPKGRNVVLEKKFGAPQIVNDGVTIAKEIELEDNIENTGVALIRQAASKTNDAAGDGTTTATVLAHAMVKEGMRNVVAGANAISLKRGIEKAAGFLVEKIAENARSVEDSTAIAQVGTISAGNDDEVGQMIANAMDKVGKEGVISLEEGKSMTTELEVTEGMRFEKGYISPYFATDTERMEAVLDEPYILLTDKKITLVQDLVPVLEQAARAGKPLLVIAEDIEKEALATLVVNRLRGVLNVAAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NITSB (60 kDa chaperonin OS=Nitratiruptor sp. (strain SB155-2) GN=groL PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.020e-81
Identity = 157/278 (56.47%), Postives = 213/278 (76.62%), Query Frame = 3
Query:    6 LHFNKXGYAMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIR-GAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +HF+    A  +L  GV KLAD V VT+GP+GRNV+++  +G+P I  DGV+VAKE+EL + VEN+GA+LV++ A+KT D AGDGTTT+ VLA  +  EG++ + AGANP+ + RG++K ++A+V+ELK+++KEV+D  E+A VA +SA N+ ++G +IAEAM KVG+ GV+T+EEGKS ++ L VVEGMQFDRGY+SPYFVTD+EKM    EN  +LL DKKI+N +DL+ VLE  ++ G  P+LIIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:    6 IHFSDI--ARGELFEGVKKLADAVKVTMGPRGRNVLIQKSFGSPSITKDGVSVAKEIELPNTVENMGAQLVKEVASKTADEAGDGTTTATVLAYNIFKEGLRNITAGANPIEVKRGMDKAAEAIVAELKKIAKEVKDKKEIAQVATISANNDPKIGELIAEAMEKVGKDGVITVEEGKSLQDELEVVEGMQFDRGYLSPYFVTDTEKMEAVLENAYILLYDKKISNMKDLLPVLEKVVQTGNKPLLIIAEDIEGEALATLVVNKLRGTLNVCAVKAPG 281          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH601_SYNFM (60 kDa chaperonin 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL1 PE=3 SV=1)

HSP 1 Score: 303.523 bits (776), Expect = 1.020e-81
Identity = 157/269 (58.36%), Postives = 203/269 (75.46%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A + L +GVN LAD V VTLGPKGRNVV+E  +G P +  DGVTVAKE+ELED  EN+GA++V++ A+KT+D+AGDGTTT+ +LAQ +  EG K+VAAGANP+ + RGIEK  + +V ELK++SK  +D  E+A V  +SA N+  +GN+IAEAM+KVG++GV+T+EE K+ E  L VVEGMQFDRGYISPYFVTD EKM V      +L+ +KKI+N +DL+ VLE   +   P+LIIAED+E EAL TLVVNKLRG L   A+K  G
Sbjct:   11 AREALLSGVNILADAVKVTLGPKGRNVVIEKAFGGPTVTKDGVTVAKEIELEDKFENMGAQMVKEVASKTSDVAGDGTTTATILAQSIYYEGSKLVAAGANPMALKRGIEKAVQVVVDELKKISKPTKDQKEIAQVGTISANNDPTIGNIIAEAMNKVGKEGVITVEEAKAMETTLEVVEGMQFDRGYISPYFVTDPEKMEVLLNEPLILINEKKISNMKDLLPVLEQIAKMGRPLLIIAEDVEGEALATLVVNKLRGTLHVCAVKAPG 279          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_PELCD (60 kDa chaperonin OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=groL PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 154/269 (57.25%), Postives = 207/269 (76.95%), Query Frame = 3
Query:   30 AMKKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            A   + +GVN+LAD V VTLGPKGRNVV++  +GAP I  DGV+VAKE+ELE+  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQG+  EGVK+V AG NP+ I RGI+K  +A V+ L+++SK ++D  E+A V  +SA ++  +G++IAEAM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD+E+M    E+  +L+ DKKI+N RD+IN+LE   +   P+LIIAEDIE EAL TLVVN+LRG L  AA+K  G
Sbjct:   12 ARSLILSGVNQLADAVKVTLGPKGRNVVIDRSFGAPLITKDGVSVAKEIELEEKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQGIYREGVKLVTAGHNPMEIKRGIDKAVEAAVAYLQELSKPIKDHKEIAQVGTISANSDKTIGDIIAEAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDAERMEAVMEDAMILIHDKKISNMRDMINILEAVAKQGRPLLIIAEDIEGEALATLVVNRLRGTLNVAAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIMB (60 kDa chaperonin OS=Neisseria meningitidis serogroup B GN=groL PE=1 SV=2)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVDELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIM0 (60 kDa chaperonin OS=Neisseria meningitidis serogroup C (strain 053442) GN=groL PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAALDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGILKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_NEIG2 (60 kDa chaperonin OS=Neisseria gonorrhoeae (strain NCCP11945) GN=groL PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 154/267 (57.68%), Postives = 204/267 (76.40%), Query Frame = 3
Query:   36 KKLQNGVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVEDS-ELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            +K+ NGVN LA+ V VTLGPKGRNVV++  +G P I  DGVTVAKE+EL+D  EN+GA++V++ A+KTND+AGDGTTT+ VLAQ ++AEG+K V AG NP  + RGI+K   ALV ELK ++K  + S E+A V ++SA ++ +VG +IAEAM KVG++GV+T+E+GKS EN L VVEGMQFDRGY+SPYF+ D+EK     +N  +LL DKKI+N RDL+ VLE   + + P+LIIAED+E EAL TLVVN +RG L+  A+K  G
Sbjct:   14 QKMVNGVNILANAVRVTLGPKGRNVVVDRAFGGPHITKDGVTVAKEIELKDKFENMGAQMVKEVASKTNDVAGDGTTTATVLAQSIVAEGMKYVTAGMNPTDLKRGIDKAVAALVEELKNIAKPCDTSKEIAQVGSISANSDEQVGAIIAEAMEKVGKEGVITVEDGKSLENELDVVEGMQFDRGYLSPYFINDAEKQIAGLDNPFVLLFDKKISNIRDLLPVLEQVAKASRPLLIIAEDVEGEALATLVVNNIRGVLKTVAVKAPG 280          
BLAST of EY659218 vs. ExPASy Swiss-Prot
Match: CH60_GEOSL (60 kDa chaperonin OS=Geobacter sulfurreducens GN=groL PE=3 SV=1)

HSP 1 Score: 303.138 bits (775), Expect = 1.332e-81
Identity = 154/262 (58.78%), Postives = 199/262 (75.95%), Query Frame = 3
Query:   51 GVNKLADLVGVTLGPKGRNVVLESKYGAPKIVNDGVTVAKEVELEDPVENIGAKLVRQAAAKTNDLAGDGTTTSVVLAQGLIAEGVKVVAAGANPVLITRGIEKTSKALVSELKQMSKEVED-SELADVAAVSAGNNYEVGNMIAEAMSKVGRKGVVTLEEGKSAENMLYVVEGMQFDRGYISPYFVTDSEKMAVEYENCKLLLVDKKITNARDLINVLEDAIRGAYPILIIAEDIEQEALGTLVVNKLRGALENAALKLLG 833
            GVN LAD V VTLGPKGRNVV+E  +G+P I  DGVTVAKE+ELED  EN+GA+LV++ A+KT+D+AGDGTTT+ VLAQ +  +G K+VAAG NP+ I RGI+K  + +V+ELK +SK ++D  E+A V  +SA N+  +G++IA+AM KVG++GV+T+EE K+ E  L  VEGMQFDRGY+SPYFVTD E+M    EN  +L+ DKKI+N +DL+ VLE   +   P+LIIAEDIE EAL TLVVNKLRG L   A+K  G
Sbjct:   19 GVNTLADAVKVTLGPKGRNVVIEKAFGSPLITKDGVTVAKEIELEDKFENMGAQLVKEVASKTSDVAGDGTTTATVLAQAIYRQGSKLVAAGHNPMEIKRGIDKAVETIVAELKSISKPIKDHKEIAQVGTISANNDKTIGDIIAQAMEKVGKEGVITVEEAKAMETSLETVEGMQFDRGYLSPYFVTDPERMEASLENAMILIHDKKISNMKDLLPVLEQTAKSGRPLLIIAEDIEGEALATLVVNKLRGVLNICAVKAPG 280          
The following BLAST results are available for this feature:
BLAST of EY659218 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CH60_CAMJE7.809e-8257.2560 kDa chaperonin OS=Campylobacter jejuni GN=groL ... [more]
CH60_ANOFW7.809e-8259.1160 kDa chaperonin OS=Anoxybacillus flavithermus (s... [more]
CH602_ACAM17.809e-8257.9960 kDa chaperonin 2 OS=Acaryochloris marina (strai... [more]
CH60_NITSB1.020e-8156.4760 kDa chaperonin OS=Nitratiruptor sp. (strain SB1... [more]
CH601_SYNFM1.020e-8158.3660 kDa chaperonin 1 OS=Syntrophobacter fumaroxidan... [more]
CH60_PELCD1.332e-8157.2560 kDa chaperonin OS=Pelobacter carbinolicus (stra... [more]
CH60_NEIMB1.332e-8157.6860 kDa chaperonin OS=Neisseria meningitidis serogr... [more]
CH60_NEIM01.332e-8157.6860 kDa chaperonin OS=Neisseria meningitidis serogr... [more]
CH60_NEIG21.332e-8157.6860 kDa chaperonin OS=Neisseria gonorrhoeae (strain... [more]
CH60_GEOSL1.332e-8158.7860 kDa chaperonin OS=Geobacter sulfurreducens GN=g... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionCS00-C1-101-004-F11-CT.F Sweet orange leaf, infected with Xylella fastidiosa (stage 1 of 2) Citrus sinensis cDNA, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>EY659218 ID=EY659218|Name=EY659218|organism=Citrus sinensis|type=EST|length=881bp
AGAACTTGCATTTCAACAAGNATGGATATGCCATGAAGAAACTTCAAAAT
GGTGTCAACAAGCTTGCAGATCTAGTTGGAGTTACCCTTGGTCCCAAGGG
CAGGAATGTTGTTCTAGAGAGCAAGTACGGTGCCCCAAAAATTGTGAATG
ATGGTGTAACTGTGGCCAAAGAAGTTGAGTTAGAGGACCCGGTTGAGAAC
ATTGGTGCTAAATTAGTGAGACAAGCAGCTGCCAAGACTAATGACTTGGC
TGGTGATGGAACAACAACATCTGTTGTTCTTGCGCAAGGGCTTATAGCTG
AAGGTGTTAAGGTCGTGGCAGCTGGTGCAAATCCTGTTCTTATCACAAGA
GGCATTGAGAAGACATCTAAGGCTCTTGTTTCTGAGCTCAAGCAGATGTC
AAAAGAGGTTGAAGATAGTGAACTTGCCGATGTAGCAGCTGTTAGTGCAG
GGAACAACTATGAAGTTGGGAATATGATTGCAGAAGCCATGAGTAAAGTG
GGACGTAAGGGTGTGGTGACCCTTGAAGAGGGAAAAAGTGCTGAGAATAT
GCTCTATGTTGTTGAGGGAATGCAATTTGATCGTGGTTATATTTCTCCCT
ACTTCGTCACTGATAGTGAGAAAATGGCAGTTGAATATGAGAACTGCAAG
TTGCTTCTTGTGGATAAAAAGATTACCAATGCAAGGGACCTTATCAACGT
TTTGGAAGATGCGATTAGAGGTGCATACCCAATTTTGATTATTGCAGAAG
ATATTGAGCAAGAAGCACTGGGCACTCTTGTCGTGAACAAGCTGAGAGGT
GCATTGGAGAATGCTGCTCTTAAGCTCCTGGGTTTGAGAGCGGCAGAGCA
GTACCTTGAGACATTGCTTTTTGACTGGAGG
back to top