EY675056
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of EY675056 vs. ExPASy Swiss-Prot
Match: RBS_MARPA (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Marchantia paleacea GN=RBCS PE=2 SV=1) HSP 1 Score: 81.2629 bits (199), Expect = 9.865e-15 Identity = 36/69 (52.17%), Postives = 48/69 (69.57%), Query Frame = 2 Query: 437 KGWVYREHHSSPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEY-PHSFVRIIGFEQQAPVEWISF 640 +G V RE + PGYYDGRYWTMWKLPM+GCTD+ VL+E+ E +K Y ++R +GF+ V+ SF Sbjct: 105 QGTVTREGSTMPGYYDGRYWTMWKLPMFGCTDSASVLREIEECKKLYGKKCYIRCLGFDNTRQVQCASF 173
BLAST of EY675056 vs. ExPASy Swiss-Prot
Match: RBS_CHLMO (Ribulose bisphosphate carboxylase small chain, chloroplastic OS=Chlamydomonas moewusii GN=RBCS PE=2 SV=1) HSP 1 Score: 76.6406 bits (187), Expect = 2.430e-13 Identity = 30/58 (51.72%), Postives = 42/58 (72.41%), Query Frame = 2 Query: 467 SPGYYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFEQQAPVEWISF 640 S GYYD RYWTMWKLPM+GCTD +QVL+EV Q +P+ ++R++ F+ V+ + F Sbjct: 92 SAGYYDNRYWTMWKLPMFGCTDPSQVLREVSACQVAFPNVYIRLVAFDNVKQVQCMGF 149
BLAST of EY675056 vs. ExPASy Swiss-Prot
Match: RBS2_CHLRE (Ribulose bisphosphate carboxylase small chain 2, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-2 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.985e-12 Identity = 28/55 (50.91%), Postives = 39/55 (70.91%), Query Frame = 2 Query: 476 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFEQQAPVEWISF 640 YYD RYWTMWKLPM+GC D QVL+E+ K +P ++VR++ F+ Q V+ + F Sbjct: 112 YYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGF 166
BLAST of EY675056 vs. ExPASy Swiss-Prot
Match: RBS1_CHLRE (Ribulose bisphosphate carboxylase small chain 1, chloroplastic OS=Chlamydomonas reinhardtii GN=RBCS-1 PE=1 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 5.985e-12 Identity = 28/55 (50.91%), Postives = 39/55 (70.91%), Query Frame = 2 Query: 476 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFEQQAPVEWISF 640 YYD RYWTMWKLPM+GC D QVL+E+ K +P ++VR++ F+ Q V+ + F Sbjct: 112 YYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNQKQVQIMGF 166
BLAST of EY675056 vs. ExPASy Swiss-Prot
Match: RBS3_ACEAT (Ribulose bisphosphate carboxylase small chain 3, chloroplastic OS=Acetabularia acetabulum GN=RBCS-3 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 6.617e-11 Identity = 27/55 (49.09%), Postives = 38/55 (69.09%), Query Frame = 2 Query: 476 YYDGRYWTMWKLPMYGCTDATQVLKEVGEVQKEYPHSFVRIIGFEQQAPVEWISF 640 Y D RYWTMWKLPM+GCTDA+QVL E+ K +P +++R++ F+ V+ F Sbjct: 109 YQDNRYWTMWKLPMFGCTDASQVLSEIQACTKAFPDAYIRLVCFDANRQVQISGF 163 The following BLAST results are available for this feature:
BLAST of EY675056 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 95
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY675056 ID=EY675056; Name=EY675056; organism=Citrus sinensis; type=EST; length=992bpback to top |