EY675040
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY675040 vs. ExPASy Swiss-Prot
Match: SUS1_HORVU (Sucrose synthase 1 OS=Hordeum vulgare GN=SS1 PE=1 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.329e-11 Identity = 25/60 (41.67%), Postives = 44/60 (73.33%), Query Frame = 1 Query: 1 QRIYECYTWKIYANKVLNMGSIYGFWRQINKEPKEAKQRYIQMFYSLLFRKLASNVPIKV 180 +RIYE YTWK+Y+ +++ + +YGFW+ ++ + +RY++MFY+L +R LA+ VP+ V Sbjct: 741 KRIYEKYTWKLYSERLMTLTGVYGFWKYVSNLERRETRRYLEMFYALKYRSLAAAVPLAV 800
BLAST of EY675040 vs. ExPASy Swiss-Prot
Match: SUS1_DAUCA (Sucrose synthase isoform 1 OS=Daucus carota PE=2 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 3.329e-11 Identity = 27/62 (43.55%), Postives = 45/62 (72.58%), Query Frame = 1 Query: 1 QRIYECYTWKIYANKVLNMGSIYGFWRQINKEPKEAKQRYIQMFYSLLFRKLASNVPIKVPE 186 +RI E YTW+IY+ ++L + +YGFW+ ++K + +RY++MFY+L +RKLA +VP+ E Sbjct: 747 KRIQEKYTWQIYSERLLTLAGVYGFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLAKDE 808
BLAST of EY675040 vs. ExPASy Swiss-Prot
Match: SUSY_MEDSA (Sucrose synthase OS=Medicago sativa PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 4.348e-11 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 1 QRIYECYTWKIYANKVLNMGSIYGFWRQINKEPKEAKQRYIQMFYSLLFRKLASNVPIKV 180 QRI E YTW IY+ ++L + +YGFW+ ++ + +RY++MFY+L +RKLA +VP+ V Sbjct: 745 QRIEEKYTWTIYSQRLLTLTGVYGFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAV 804
BLAST of EY675040 vs. ExPASy Swiss-Prot
Match: SUSY_ALNGL (Sucrose synthase OS=Alnus glutinosa GN=SUS1 PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.685e-11 Identity = 27/60 (45.00%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 1 QRIYECYTWKIYANKVLNMGSIYGFWRQINKEPKEAKQRYIQMFYSLLFRKLASNVPIKV 180 QRI+E YTWKIY+ ++L + + FW+ ++ + +RYI+MFY+L +RKLA +VP+ V Sbjct: 743 QRIHEKYTWKIYSERLLTLTGVTAFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAV 802
BLAST of EY675040 vs. ExPASy Swiss-Prot
Match: SUS2_HORVU (Sucrose synthase 2 OS=Hordeum vulgare GN=SS2 PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 9.685e-11 Identity = 24/60 (40.00%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 1 QRIYECYTWKIYANKVLNMGSIYGFWRQINKEPKEAKQRYIQMFYSLLFRKLASNVPIKV 180 QRI E YTWK+Y+ +++ + +YGFW+ ++ + +RY++M Y+L +RK+A+ VP+ V Sbjct: 750 QRIEEKYTWKLYSERLMTLSGVYGFWKYVSNLDRRETRRYLEMLYALKYRKMAATVPLAV 809 The following BLAST results are available for this feature:
BLAST of EY675040 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY675040 ID=EY675040; Name=EY675040; organism=Citrus sinensis; type=EST; length=574bpback to top |