EY703225
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY703225 vs. ExPASy Swiss-Prot
Match: GLNA_PANAR (Glutamine synthetase OS=Panulirus argus PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.606e-11 Identity = 35/59 (59.32%), Postives = 41/59 (69.49%), Query Frame = 3 Query: 12 ETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWE 188 ET+SI FS GVANRG SIR+ R ++ GYLEDRRP+SN DPYVV+ L T L E Sbjct: 302 ETSSIHDFSAGVANRGASIRIPRGVAEEKTGYLEDRRPSSNADPYVVSERLVRTICLNE 360
BLAST of EY703225 vs. ExPASy Swiss-Prot
Match: GLNA_MOUSE (Glutamine synthetase OS=Mus musculus GN=Glul PE=1 SV=6) HSP 1 Score: 68.5514 bits (166), Expect = 4.606e-11 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 3 Query: 12 ETASIDSFSWGVANRGCSIRVGRETEKQGKGYLEDRRPASNMDPYVVTSLLAETTILWE 188 ET++I+ FS GVANRG SIR+ R ++ KGY EDRRP++N DPY VT + T +L E Sbjct: 305 ETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPSANCDPYAVTEAIVRTCLLNE 363 The following BLAST results are available for this feature:
BLAST of EY703225 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 72
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY703225 ID=EY703225; Name=EY703225; organism=Citrus sinensis; type=EST; length=790bpback to top |