DY306122
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DY306122 vs. ExPASy Swiss-Prot
Match: ISPH_PROM0 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Prochlorococcus marinus (strain MIT 9301) GN=ispH PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.041e-12 Identity = 38/75 (50.67%), Postives = 53/75 (70.67%), Query Frame = 2 Query: 2 HLQEIAEDRGIPSYWIDSEKRIG-PGNKIAYKLMHGELVEKENWLPNGQITIGITSGASTPDKAVEEVLKKVFEI 223 HLQEIA + I S+ ID+ +RI N I +K + EL K N+LP+G+I +GITSGASTPDK V +V++K+ +I Sbjct: 322 HLQEIAITKNISSFHIDTPERISVKENSIFHKPLGSELELKNNFLPSGKINVGITSGASTPDKVVADVIEKLIDI 396
BLAST of DY306122 vs. ExPASy Swiss-Prot
Match: ISPH_SYNS9 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Synechococcus sp. (strain CC9902) GN=ispH PE=3 SV=1) HSP 1 Score: 69.3218 bits (168), Expect = 6.746e-12 Identity = 37/75 (49.33%), Postives = 51/75 (68.00%), Query Frame = 2 Query: 2 HLQEIAEDRGIPSYWIDSEKRIGPG-NKIAYKLMHGELVEKENWLPNGQITIGITSGASTPDKAVEEVLKKVFEI 223 HLQEIA RGI S+ ID+ RI N I +K + +L + +LP G +T+GITSGASTPD+AVE V++K+ + Sbjct: 322 HLQEIAVSRGIRSFHIDTPDRIDETTNSIEHKPLSEDLKRDQVFLPAGPVTVGITSGASTPDRAVEAVIEKLMRL 396
BLAST of DY306122 vs. ExPASy Swiss-Prot
Match: ISPH_PROM9 (4-hydroxy-3-methylbut-2-enyl diphosphate reductase OS=Prochlorococcus marinus (strain MIT 9312) GN=ispH PE=3 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 3.348e-11 Identity = 36/72 (50.00%), Postives = 50/72 (69.44%), Query Frame = 2 Query: 2 HLQEIAEDRGIPSYWIDSEKRIG-PGNKIAYKLMHGELVEKENWLPNGQITIGITSGASTPDKAVEEVLKKV 214 HLQEIA + I S+ ID+ +RI N I +K + +L K N+LP+G I +GITSGASTPDK V +V++K+ Sbjct: 322 HLQEIAITKNITSFHIDTPERISVEENSILHKPLGLDLELKNNFLPSGNINVGITSGASTPDKVVADVIEKL 393 The following BLAST results are available for this feature:
BLAST of DY306122 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 33
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DY306122 ID=DY306122; Name=DY306122; organism=Citrus sinensis; type=EST; length=393bpback to top |