CX078283
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_CAEEL (Enolase OS=Caenorhabditis elegans GN=enol-1 PE=1 SV=3) HSP 1 Score: 78.9518 bits (193), Expect = 8.647e-15 Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQLLRIEEELGA+AVYAG FR P Sbjct: 391 TGQIKTGAPCRSERLAKYNQLLRIEEELGADAVYAGHNFRNP 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_LOLPE (Enolase OS=Loligo pealeii PE=2 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.286e-14 Identity = 36/44 (81.82%), Postives = 41/44 (93.18%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPVE 134 TGQIKTGAPCRSERLAKYNQ+LRIEEELG +AV+AG KFR P++ Sbjct: 391 TGQIKTGAPCRSERLAKYNQILRIEEELGDKAVFAGKKFRNPLK 434
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_NEOFR (Enolase OS=Neocallimastix frontalis PE=3 SV=1) HSP 1 Score: 75.8702 bits (185), Expect = 7.320e-14 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 +GQIKTGAPCRSERLAKYNQLLRIEEELGA A YAG FR P Sbjct: 394 SGQIKTGAPCRSERLAKYNQLLRIEEELGANATYAGENFRRP 435
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_XENLA (Alpha-enolase OS=Xenopus laevis GN=eno1 PE=2 SV=2) HSP 1 Score: 75.485 bits (184), Expect = 9.560e-14 Identity = 36/43 (83.72%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 131 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR PV Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGKNFRKPV 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_SCHJA (Enolase OS=Schistosoma japonicum GN=ENO PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13 Identity = 36/42 (85.71%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQLLRIEEELG+ A YAG FR P Sbjct: 391 TGQIKTGAPCRSERLAKYNQLLRIEEELGSTAKYAGKHFRHP 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_HOMGA (Enolase OS=Homarus gammarus PE=1 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQ+LRIEEELG+ A +AG FRAP Sbjct: 391 TGQIKTGAPCRSERLAKYNQILRIEEELGSGAKFAGKNFRAP 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_PONAB (Alpha-enolase OS=Pongo abelii GN=ENO1 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 131 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR P+ Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_MACFA (Alpha-enolase OS=Macaca fascicularis GN=ENO1 PE=2 SV=1) HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 131 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR P+ Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_HUMAN (Alpha-enolase OS=Homo sapiens GN=ENO1 PE=1 SV=2) HSP 1 Score: 74.3294 bits (181), Expect = 2.130e-13 Identity = 35/43 (81.40%), Postives = 39/43 (90.70%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 131 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR P+ Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPL 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOB_RAT (Beta-enolase OS=Rattus norvegicus GN=Eno3 PE=1 SV=3) HSP 1 Score: 73.9442 bits (180), Expect = 2.782e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQL+RIEE LG +AV+AG KFR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLMRIEEALGDKAVFAGRKFRNP 431 The following BLAST results are available for this feature:
BLAST of CX078283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 69
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX078283 ID=CX078283; Name=CX078283; organism=Citrus sinensis; type=EST; length=382bpback to top |