CX078283
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_CHICK (Alpha-enolase OS=Gallus gallus GN=ENO1 PE=2 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGRNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_ANAPL (Alpha-enolase OS=Anas platyrhynchos GN=ENO1 PE=2 SV=2) HSP 1 Score: 73.559 bits (179), Expect = 3.633e-13 Identity = 35/42 (83.33%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQLLRIEEELG++A +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLLRIEEELGSKARFAGRNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_SCHMA (Enolase OS=Schistosoma mansoni GN=ENO PE=2 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 4.745e-13 Identity = 35/42 (83.33%), Postives = 36/42 (85.71%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRS+RLAKYNQLLRIEEELG A YAG FR P Sbjct: 391 TGQIKTGAPCRSDRLAKYNQLLRIEEELGTAAKYAGKNFRHP 432
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_ASPFU (Enolase OS=Aspergillus fumigatus GN=enoA PE=1 SV=3) HSP 1 Score: 73.1738 bits (178), Expect = 4.745e-13 Identity = 35/43 (81.40%), Postives = 38/43 (88.37%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAPV 131 +GQIKTGAPCRSERLAK NQ+LRIEEELG AVYAG+KFR V Sbjct: 394 SGQIKTGAPCRSERLAKLNQILRIEEELGENAVYAGSKFRTAV 436
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOG_RAT (Gamma-enolase OS=Rattus norvegicus GN=Eno2 PE=1 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 4.745e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQL+RIEEELG EA +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLMRIEEELGEEARFAGHNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOG_MOUSE (Gamma-enolase OS=Mus musculus GN=Eno2 PE=1 SV=2) HSP 1 Score: 72.7886 bits (177), Expect = 6.197e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQL+RIEEELG EA +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOG_HUMAN (Gamma-enolase OS=Homo sapiens GN=ENO2 PE=1 SV=3) HSP 1 Score: 72.7886 bits (177), Expect = 6.197e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQL+RIEEELG EA +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOG_CHICK (Gamma-enolase OS=Gallus gallus GN=ENO2 PE=2 SV=1) HSP 1 Score: 72.7886 bits (177), Expect = 6.197e-13 Identity = 35/42 (83.33%), Postives = 37/42 (88.10%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQL+RIEEELG EA +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQLMRIEEELGDEARFAGHNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENOA_ALLMI (Alpha-enolase OS=Alligator mississippiensis PE=2 SV=3) HSP 1 Score: 72.7886 bits (177), Expect = 6.197e-13 Identity = 34/42 (80.95%), Postives = 38/42 (90.48%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFRAP 128 TGQIKTGAPCRSERLAKYNQ+LRIEEELG++A +AG FR P Sbjct: 390 TGQIKTGAPCRSERLAKYNQILRIEEELGSKARFAGRNFRNP 431
BLAST of CX078283 vs. ExPASy Swiss-Prot
Match: ENO_CUNEL (Enolase (Fragment) OS=Cunninghamella elegans PE=2 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 1.057e-12 Identity = 34/40 (85.00%), Postives = 36/40 (90.00%), Query Frame = 3 Query: 3 TGQIKTGAPCRSERLAKYNQLLRIEEELGAEAVYAGAKFR 122 TGQIKTGAPCRSERLAKYN+LLRIEEELG A+YAG FR Sbjct: 392 TGQIKTGAPCRSERLAKYNELLRIEEELGDAAIYAGEHFR 431 The following BLAST results are available for this feature:
BLAST of CX078283 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 69
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX078283 ID=CX078283; Name=CX078283; organism=Citrus sinensis; type=EST; length=382bpback to top |