EY736063
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of EY736063 vs. ExPASy Swiss-Prot
Match: RS37_YEAST (40S ribosomal protein S31 OS=Saccharomyces cerevisiae GN=UBI3 PE=1 SV=2) HSP 1 Score: 73.1738 bits (178), Expect = 1.385e-12 Identity = 32/49 (65.31%), Postives = 36/49 (73.47%), Query Frame = 3 Query: 342 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTY 488 LAVL +YKVD GKV +LR+EC N CGAG F+ANH DR YCGKC Y Sbjct: 24 LAVLSYYKVDAEGKVTKLRRECSNPTCGAGVFLANHKDRLYCGKCHSVY 72
BLAST of EY736063 vs. ExPASy Swiss-Prot
Match: RS27A_DICDI (40S ribosomal protein S27a OS=Dictyostelium discoideum GN=ubqC PE=3 SV=1) HSP 1 Score: 70.0922 bits (170), Expect = 1.173e-11 Identity = 29/50 (58.00%), Postives = 38/50 (76.00%), Query Frame = 3 Query: 342 LAVLQFYKVDDSGKVQRLRKECPNAECGAGTFMANHFDRHYCGKCGLTYV 491 LAVL++YK D++GK++R+ +ECP CGAG FMA H +R YCGKC T V Sbjct: 25 LAVLKYYKFDENGKIKRVLRECPAETCGAGVFMAQHANRQYCGKCHSTLV 74 The following BLAST results are available for this feature:
BLAST of EY736063 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 122
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >EY736063 ID=EY736063; Name=EY736063; organism=Citrus sinensis; type=EST; length=665bpback to top |