DR404096
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_ORYSJ (Inositol-3-phosphate synthase OS=Oryza sativa subsp. japonica GN=INO1 PE=2 SV=2) HSP 1 Score: 72.4034 bits (176), Expect = 9.459e-13 Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_MAIZE (Inositol-3-phosphate synthase OS=Zea mays PE=2 SV=2) HSP 1 Score: 72.4034 bits (176), Expect = 9.459e-13 Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_HORVU (Inositol-3-phosphate synthase OS=Hordeum vulgare PE=2 SV=1) HSP 1 Score: 72.4034 bits (176), Expect = 9.459e-13 Identity = 34/36 (94.44%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPVVNAL+KQRAMLENI+RACVGLAPENNMILEYK Sbjct: 475 GTPVVNALAKQRAMLENIMRACVGLAPENNMILEYK 510
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_PHAVU (Inositol-3-phosphate synthase OS=Phaseolus vulgaris PE=2 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 2.752e-12 Identity = 32/36 (88.89%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K Sbjct: 476 GTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511
BLAST of DR404096 vs. ExPASy Swiss-Prot
Match: INO1_ARATH (Inositol-3-phosphate synthase isozyme 1 OS=Arabidopsis thaliana GN=At4g39800 PE=2 SV=3) HSP 1 Score: 70.8626 bits (172), Expect = 2.752e-12 Identity = 32/36 (88.89%), Postives = 36/36 (100.00%), Query Frame = 1 Query: 4 GTPVVNALSKQRAMLENILRACVGLAPENNMILEYK 111 GTPV+NALSKQRAMLENI+RACVGLAPENNMI+E+K Sbjct: 476 GTPVINALSKQRAMLENIMRACVGLAPENNMIMEFK 511 The following BLAST results are available for this feature:
BLAST of DR404096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 15
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DR404096 ID=DR404096; Name=DR404096; organism=Citrus sinensis; type=EST; length=444bpback to top |