CX069727
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of CX069727 vs. ExPASy Swiss-Prot
Match: MK13_RAT (Mitogen-activated protein kinase 13 OS=Rattus norvegicus GN=Mapk13 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 8.658e-11 Identity = 34/77 (44.16%), Postives = 50/77 (64.94%), Query Frame = 2 Query: 134 YVQYNILGNLFQVSSKYVPPLQPIGRGAYGIVCSAVNSETKEEVAIKKITNAFDNRIDAKRILREIKLLCHMNHENV 364 + + +I +++ Y+ P +G GAYG VCSA++ T E+VAIKK++ F + I AKR RE+ LL HM+HENV Sbjct: 9 FYKQDINKTAWELPKTYLAPAH-VGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMHHENV 84
BLAST of CX069727 vs. ExPASy Swiss-Prot
Match: MK13_MOUSE (Mitogen-activated protein kinase 13 OS=Mus musculus GN=Mapk13 PE=2 SV=2) HSP 1 Score: 67.781 bits (164), Expect = 8.658e-11 Identity = 34/77 (44.16%), Postives = 50/77 (64.94%), Query Frame = 2 Query: 134 YVQYNILGNLFQVSSKYVPPLQPIGRGAYGIVCSAVNSETKEEVAIKKITNAFDNRIDAKRILREIKLLCHMNHENV 364 + + +I +++ Y+ P +G GAYG VCSA++ T E+VAIKK++ F + I AKR RE+ LL HM+HENV Sbjct: 9 FYKQDINKTAWELPKTYLAPAH-VGSGAYGAVCSAIDKRTGEKVAIKKLSRPFQSEIFAKRAYRELLLLKHMHHENV 84 The following BLAST results are available for this feature:
BLAST of CX069727 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 82
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069727 ID=CX069727; Name=CX069727; organism=Citrus sinensis; type=EST; length=832bpback to top |