CX069713
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX069713 vs. ExPASy Swiss-Prot
Match: H2B1_PICGU (Histone H2B.1 OS=Pichia guilliermondii GN=HTB1 PE=3 SV=1) HSP 1 Score: 77.0258 bits (188), Expect = 3.273e-14 Identity = 36/49 (73.47%), Postives = 45/49 (91.84%), Query Frame = 2 Query: 2 EASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS 148 EAS+LA YNKK TI++REIQTAVRL+LPGELAKHAVSE T+ +TK++S+ Sbjct: 79 EASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEATRTITKYSSA 127
BLAST of CX069713 vs. ExPASy Swiss-Prot
Match: H2B_YARLI (Histone H2B OS=Yarrowia lipolytica GN=HTB1 PE=3 SV=3) HSP 1 Score: 73.9442 bits (180), Expect = 2.771e-13 Identity = 35/48 (72.92%), Postives = 42/48 (87.50%), Query Frame = 2 Query: 2 EASRLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 145 EAS+LA Y KK TITSREIQTAVRL+LPGELAKHA +GT+AV K+++ Sbjct: 89 EASKLATYTKKSTITSREIQTAVRLILPGELAKHATGDGTRAVAKYST 136 The following BLAST results are available for this feature:
BLAST of CX069713 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 192
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069713 ID=CX069713; Name=CX069713; organism=Citrus sinensis; type=EST; length=384bpback to top |