CX069516
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CX069516 vs. ExPASy Swiss-Prot
Match: VTC1A_DANRE (V-type proton ATPase subunit C 1-A OS=Danio rerio GN=atp6v1c1a PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.543e-11 Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 3 Query: 33 EEEGWEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANST 287 ++E +L D++ L++W ++ E F +W+H A+RVF ES+LRYGLP +F A +L P+ K KK+R +L +L + +S+ Sbjct: 261 DKEEMTRLSTDKKKQFGPLVRWLKVNFSEAFIAWVHIKALRVFVESVLRYGLPVNFQAMLLQPNKKNMKKLREVLYDLYKHLDSS 345
BLAST of CX069516 vs. ExPASy Swiss-Prot
Match: VATC1_XENLA (V-type proton ATPase subunit C 1 OS=Xenopus laevis GN=atp6v1c1 PE=2 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 4.543e-11 Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 3 Query: 33 EEEGWEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANST 287 ++E +L D++ L++W ++ E F +W+H A+RVF ES+LRYGLP +F A +L P+ K KK+R +L +L + +S+ Sbjct: 261 DKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLNDLYKHLDSS 345
BLAST of CX069516 vs. ExPASy Swiss-Prot
Match: VATC_CAEBR (V-type proton ATPase subunit C OS=Caenorhabditis briggsae GN=vha-11 PE=3 SV=1) HSP 1 Score: 68.1662 bits (165), Expect = 5.933e-11 Identity = 30/73 (41.10%), Postives = 52/73 (71.23%), Query Frame = 3 Query: 48 EKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEEL 266 +KL+ +++ + L++W ++GE+FS+++H A+RVF ES+LRYGLP +F A V+ P+ KK+R L++L Sbjct: 269 DKLLAEKQKQYAPLIRWLKINFGEIFSAYIHIKALRVFVESVLRYGLPVNFQAAVIEPAKGQSKKLRQELQKL 341
BLAST of CX069516 vs. ExPASy Swiss-Prot
Match: VATC1_XENTR (V-type proton ATPase subunit C 1 OS=Xenopus tropicalis GN=atp6v1c1 PE=2 SV=1) HSP 1 Score: 67.781 bits (164), Expect = 7.749e-11 Identity = 32/85 (37.65%), Postives = 54/85 (63.53%), Query Frame = 3 Query: 33 EEEGWEKLVHDQESLRSSLLQWCYTSYGEVFSSWMHFCAVRVFAESILRYGLPPSFLACVLAPSVKGEKKVRSILEELCGNANST 287 ++E +L D++ L++W ++ E F +W+H A+RVF ES+LRYGLP +F A +L P+ K KK+R +L +L + +S+ Sbjct: 261 DKEEMNRLSTDKKKQFGPLVRWLKVNFSEAFIAWIHVKALRVFVESVLRYGLPVNFQAMLLQPNKKTMKKLREVLYDLYKHLDSS 345 The following BLAST results are available for this feature:
BLAST of CX069516 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 14
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CX069516 ID=CX069516; Name=CX069516; organism=Citrus sinensis; type=EST; length=784bpback to top |