DN792582
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSG1_ORYGL (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza glaberrima GN=WAXY PE=1 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 2.959e-21 Identity = 29/40 (72.50%), Postives = 33/40 (82.50%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 YP K R V KFN PLAH+I+AGAD + +PSRFEPCGLIQL Sbjct: 453 YPGKVRAVVKFNAPLAHLIMAGADVLAVPSRFEPCGLIQL 492 HSP 2 Score: 56.225 bits (134), Expect = 2.959e-21 Identity = 27/43 (62.79%), Postives = 31/43 (72.09%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDP 255 + MRYGT ASTGGLVDTV EG TGF MG SV+C+ V+P Sbjct: 492 LQGMRYGTPCACASTGGLVDTVIEGKTGFHMGRLSVNCKVVEP 534
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSG1_SORBI (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1) HSP 1 Score: 60.8474 bits (146), Expect = 6.939e-20 Identity = 27/40 (67.50%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 YP+K R V KFN LAH I+AGAD + + SRFEPCGLIQL Sbjct: 452 YPDKVRAVVKFNAALAHHIMAGADLLAVTSRFEPCGLIQL 491 HSP 2 Score: 57.3806 bits (137), Expect = 6.939e-20 Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDP 255 + MRYGT ASTGGLVDT+ EG TGF MG SVDC V+P Sbjct: 491 LQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEP 533
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSG1_WHEAT (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Triticum aestivum GN=WAXY PE=1 SV=1) HSP 1 Score: 59.3066 bits (142), Expect = 1.526e-19 Identity = 25/40 (62.50%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 +P K R V +FN PLAH ++AGAD + + SRFEPCGLIQL Sbjct: 459 FPTKVRAVVRFNAPLAHQMMAGADVLAVTSRFEPCGLIQL 498 HSP 2 Score: 57.7658 bits (138), Expect = 1.526e-19 Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDP 255 + MRYGT ASTGGLVDT+ EG TGF MG SVDC V+P Sbjct: 498 LQGMRYGTPCACASTGGLVDTIVEGKTGFHMGRLSVDCNVVEP 540
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSG1_MAIZE (Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1) HSP 1 Score: 57.3806 bits (137), Expect = 7.383e-19 Identity = 26/40 (65.00%), Postives = 30/40 (75.00%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 +P K R V KFN LAH I+AGAD + + SRFEPCGLIQL Sbjct: 449 FPGKVRAVVKFNAALAHHIMAGADVLAVTSRFEPCGLIQL 488 HSP 2 Score: 57.3806 bits (137), Expect = 7.383e-19 Identity = 27/43 (62.79%), Postives = 30/43 (69.77%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFSVDCEAVDP 255 + MRYGT ASTGGLVDT+ EG TGF MG SVDC V+P Sbjct: 488 LQGMRYGTPCACASTGGLVDTIIEGKTGFHMGRLSVDCNVVEP 530
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSY1_ARATH (Soluble starch synthase, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=At5g24300 PE=2 SV=1) HSP 1 Score: 56.9954 bits (136), Expect = 1.335e-12 Identity = 25/44 (56.82%), Postives = 32/44 (72.73%), Query Frame = 2 Query: 2 EILYPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQLH 133 E Y +K RG FN+P++H I AG D +L+PSRFEPCGL QL+ Sbjct: 508 EETYRDKFRGWVGFNVPISHRITAGCDILLMPSRFEPCGLNQLY 551 HSP 2 Score: 36.5798 bits (83), Expect = 1.335e-12 Identity = 15/25 (60.00%), Postives = 20/25 (80.00%), Query Frame = 1 Query: 121 HSITSMRYGTVPIVASTGGLVDTVE 195 + + +MRYGT+P+V TGGL DTVE Sbjct: 548 NQLYAMRYGTIPVVHGTGGLRDTVE 572
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: GLGA_THEYD (Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glgA PE=3 SV=1) HSP 1 Score: 49.6766 bits (117), Expect = 1.345e-12 Identity = 23/40 (57.50%), Postives = 27/40 (67.50%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 YP K F+ LAH I AGAD +L+PSR+EPCGL QL Sbjct: 364 YPSKVFAFIGFDEALAHKIYAGADSLLVPSRYEPCGLSQL 403 HSP 2 Score: 43.8986 bits (102), Expect = 1.345e-12 Identity = 19/35 (54.29%), Postives = 24/35 (68.57%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTVEEGFTGFQMGSFS 231 + +MRYGT+PI TGGL DTVE+ TGF +S Sbjct: 403 LIAMRYGTIPICRKTGGLSDTVEDKVTGFLFSEYS 437
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSY1_SOLTU (Soluble starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum PE=2 SV=1) HSP 1 Score: 55.0694 bits (131), Expect = 2.253e-12 Identity = 24/44 (54.55%), Postives = 32/44 (72.73%), Query Frame = 2 Query: 2 EILYPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQLH 133 E L+ +K R FN+P++H I AG D +L+PSRFEPCGL QL+ Sbjct: 497 ENLFKDKFRAWVGFNVPVSHRITAGCDILLMPSRFEPCGLNQLY 540 HSP 2 Score: 37.7354 bits (86), Expect = 2.253e-12 Identity = 16/26 (61.54%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 121 HSITSMRYGTVPIVASTGGLVDTVEE 198 + + +MRYGT+PIV STGGL DTV++ Sbjct: 537 NQLYAMRYGTIPIVHSTGGLRDTVKD 562
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSY1_WHEAT (Starch synthase 1, chloroplastic/amyloplastic OS=Triticum aestivum GN=WSSI-2 PE=2 SV=2) HSP 1 Score: 55.0694 bits (131), Expect = 8.308e-12 Identity = 24/44 (54.55%), Postives = 32/44 (72.73%), Query Frame = 2 Query: 2 EILYPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQLH 133 E Y +K RG F++P++H I AG D +L+PSRFEPCGL QL+ Sbjct: 504 ESSYKDKFRGWVGFSVPVSHRITAGCDILLMPSRFEPCGLNQLY 547 HSP 2 Score: 35.8094 bits (81), Expect = 8.308e-12 Identity = 20/48 (41.67%), Postives = 27/48 (56.25%), Query Frame = 1 Query: 121 HSITSMRYGTVPIVASTGGLVDTVE---------EGFTGFQMGSFSVD 237 + + +M+YGTVP+V TGGL DTVE E TG+ +VD Sbjct: 544 NQLYAMQYGTVPVVHGTGGLRDTVETFNPFGAKGEEGTGWAFSPLTVD 591
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: GLGA_MYXXD (Glycogen synthase OS=Myxococcus xanthus (strain DK 1622) GN=glgA PE=3 SV=1) HSP 1 Score: 46.595 bits (109), Expect = 1.088e-11 Identity = 20/41 (48.78%), Postives = 30/41 (73.17%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQLH 133 YP++ F+ L+H++ AGADF L+PSR+EPCGL Q++ Sbjct: 350 YPKQVGVHIGFDPGLSHLVEAGADFFLMPSRYEPCGLNQMY 390 HSP 2 Score: 43.8986 bits (102), Expect = 1.088e-11 Identity = 20/26 (76.92%), Postives = 22/26 (84.62%), Query Frame = 1 Query: 133 SMRYGTVPIVASTGGLVDTVEEGFTG 210 S+RYGTVPIV +TGGLVDTVE G G Sbjct: 391 SLRYGTVPIVRATGGLVDTVEGGLDG 416
BLAST of DN792582 vs. ExPASy Swiss-Prot
Match: SSY3_SOLTU (Soluble starch synthase 3, chloroplastic/amyloplastic OS=Solanum tuberosum GN=SS3 PE=1 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 1.376e-11 Identity = 24/40 (60.00%), Postives = 31/40 (77.50%), Query Frame = 2 Query: 11 YPEKARGVAKFNIPLAHMIIAGADFILIPSRFEPCGLIQL 130 Y ++AR ++ PL+H+I AGADFIL+PS FEPCGL QL Sbjct: 1090 YNDRARLCLTYDEPLSHLIYAGADFILVPSIFEPCGLTQL 1129 HSP 2 Score: 36.5798 bits (83), Expect = 1.376e-11 Identity = 14/22 (63.64%), Postives = 19/22 (86.36%), Query Frame = 1 Query: 127 ITSMRYGTVPIVASTGGLVDTV 192 +T+MRYG++P+V TGGL DTV Sbjct: 1129 LTAMRYGSIPVVRKTGGLYDTV 1150 The following BLAST results are available for this feature:
BLAST of DN792582 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 28
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN792582 ID=DN792582; Name=DN792582; organism=Citrus sinensis; type=EST; length=256bpback to top |