DN621146
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN621146 vs. ExPASy Swiss-Prot
Match: UBE2W_DICDI (Probable ubiquitin-conjugating enzyme E2 W OS=Dictyostelium discoideum GN=ube2w PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.751e-11 Identity = 37/85 (43.53%), Postives = 48/85 (56.47%), Query Frame = -3 Query: 447 EDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAF-RTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLT 698 +++ W + G S Y G F + F YP P+V F T HP+I SNG ICL IL + WSPALT+S V LSI S+L+ Sbjct: 30 DNLDKWVIAVDGTEGSIYQGEHFKLQFKFSSGYPLDSPEVIFIGTPPIHPHIYSNGHICLSILYDNWSPALTVSSVCLSILSMLS 114
BLAST of DN621146 vs. ExPASy Swiss-Prot
Match: UBE2W_MOUSE (Probable ubiquitin-conjugating enzyme E2 W OS=Mus musculus GN=Ube2w PE=2 SV=1) HSP 1 Score: 68.9366 bits (167), Expect = 2.987e-11 Identity = 36/88 (40.91%), Postives = 48/88 (54.55%), Query Frame = -3 Query: 447 VAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTK--VFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLT 704 V + W + G P + Y G F + F YPF P+V F + HP++ SNG ICL IL E WSPAL++ V LSI S+L+ Sbjct: 30 VQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117
BLAST of DN621146 vs. ExPASy Swiss-Prot
Match: UBE2W_HUMAN (Probable ubiquitin-conjugating enzyme E2 W OS=Homo sapiens GN=UBE2W PE=1 SV=1) HSP 1 Score: 68.5514 bits (166), Expect = 3.901e-11 Identity = 36/88 (40.91%), Postives = 48/88 (54.55%), Query Frame = -3 Query: 447 VAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKVAFRTKVF--HPNINSNGSICLDILKEQWSPALTISKVLLSICSLLT 704 V + W + G P + Y G F + F YPF P+V F + HP++ SNG ICL IL E WSPAL++ V LSI S+L+ Sbjct: 30 VQNSITQWIVDMEGAPGTLYEGEKFQLLFKFSSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117 The following BLAST results are available for this feature:
BLAST of DN621146 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 253
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN621146 ID=DN621146; Name=DN621146; organism=Citrus sinensis; type=EST; length=718bpback to top |