DN617823
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_ASPCL (Nascent polypeptide-associated complex subunit alpha OS=Aspergillus clavatus GN=egd2 PE=3 SV=1) HSP 1 Score: 73.1738 bits (178), Expect = 1.151e-12 Identity = 33/52 (63.46%), Postives = 45/52 (86.54%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KLG+K V G++RVT++R KNILF I++PDV++SP S T++IFGEAKIED Sbjct: 55 AIGKLGLKHVPGITRVTLRRPKNILFVINQPDVYRSPTSNTWIIFGEAKIED 106
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_NEUCR (Nascent polypeptide-associated complex subunit alpha OS=Neurospora crassa GN=egd-2 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.565e-12 Identity = 32/52 (61.54%), Postives = 44/52 (84.62%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KL ++ V G++RVT++R KNILF I+ P+V+KSPNS TY++FGEAKIED Sbjct: 58 AIEKLHLQRVPGITRVTLRRPKNILFVINNPEVYKSPNSNTYIVFGEAKIED 109
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_BOTFB (Nascent polypeptide-associated complex subunit alpha OS=Botryotinia fuckeliana (strain B05.10) GN=egd2 PE=3 SV=1) HSP 1 Score: 72.0182 bits (175), Expect = 2.565e-12 Identity = 31/52 (59.62%), Postives = 44/52 (84.62%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 ++ KLG+ V G++RVT++R KNILF I++P+V+KSP S TY++FGEAKIED Sbjct: 60 SIAKLGLTRVPGITRVTLRRPKNILFVINQPEVYKSPTSNTYIVFGEAKIED 111
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_SCLS1 (Nascent polypeptide-associated complex subunit alpha OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=egd2 PE=3 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 3.349e-12 Identity = 31/52 (59.62%), Postives = 43/52 (82.69%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 ++ KLG+ V G++RVT++R KNILF I+ P+V+KSP S TY++FGEAKIED Sbjct: 61 SIAKLGLTRVPGITRVTLRRPKNILFVINNPEVYKSPTSNTYIVFGEAKIED 112
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA2_HUMAN (Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens GN=NACA2 PE=1 SV=1) HSP 1 Score: 71.633 bits (174), Expect = 3.349e-12 Identity = 34/52 (65.38%), Postives = 44/52 (84.62%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 AM KLG+ VTGV+RVTI ++KNILF I+K DV+KSP S+ Y++FGEAKI+D Sbjct: 79 AMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQD 130
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_CHAGB (Nascent polypeptide-associated complex subunit alpha OS=Chaetomium globosum GN=EGD2 PE=3 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 4.375e-12 Identity = 32/52 (61.54%), Postives = 43/52 (82.69%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KL + V G++RVT++R KNILF I+ P+V+KSPNS TY++FGEAKIED Sbjct: 58 AIEKLHLTRVPGITRVTLRRPKNILFVINNPEVYKSPNSNTYIVFGEAKIED 109
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_AJECN (Nascent polypeptide-associated complex subunit alpha OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=EGD2 PE=3 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 4.375e-12 Identity = 32/52 (61.54%), Postives = 45/52 (86.54%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KLG+K V G++RVT++R K ILF I++PDV++SP+S T++IFGEAKIED Sbjct: 57 AIGKLGLKHVPGITRVTLRRPKGILFVINQPDVYRSPSSNTWIIFGEAKIED 108
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_GIBZE (Nascent polypeptide-associated complex subunit alpha OS=Gibberella zeae GN=EGD2 PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.713e-12 Identity = 31/52 (59.62%), Postives = 43/52 (82.69%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KL + + G++RVT++R KNILF I+ P+V+KSPNS TY++FGEAKIED Sbjct: 58 ALEKLHLTRIPGITRVTLRRPKNILFVINTPEVYKSPNSNTYIVFGEAKIED 109
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_ASPTN (Nascent polypeptide-associated complex subunit alpha OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=egd2 PE=3 SV=1) HSP 1 Score: 70.8626 bits (172), Expect = 5.713e-12 Identity = 32/52 (61.54%), Postives = 45/52 (86.54%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KLG+K V G++RVT +R KNILF I++P+V++SP+S T++IFGEAKIED Sbjct: 55 AIGKLGLKLVPGITRVTFRRPKNILFVINQPEVYRSPSSNTWIIFGEAKIED 106
BLAST of DN617823 vs. ExPASy Swiss-Prot
Match: NACA_MAGGR (Nascent polypeptide-associated complex subunit alpha OS=Magnaporthe grisea GN=EGD2 PE=3 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 1.273e-11 Identity = 32/52 (61.54%), Postives = 43/52 (82.69%), Query Frame = 3 Query: 300 AMLKLGMKPVTGVSRVTIKRTKNILFFISKPDVFKSPNSETYVIFGEAKIED 455 A+ KL + V G++RVT++R KNILF I+ P+V+KSPNS TY++FGEAKIED Sbjct: 57 AIEKLHLIRVDGITRVTLRRPKNILFVINNPEVYKSPNSGTYIVFGEAKIED 108 The following BLAST results are available for this feature:
BLAST of DN617823 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 41
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >DN617823 ID=DN617823; Name=DN617823; organism=Citrus sinensis; type=EST; length=604bpback to top |