DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TRYCR (Tubulin beta chain OS=Trypanosoma cruzi PE=3 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 2.027e-41
Identity = 77/86 (89.53%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSS+CDIPP+GL MA TF+GN+T IQEMFRRV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  344 WIPNNIKSSICDIPPKGLKMAVTFVGNNTCIQEMFRRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PLAFK (Tubulin beta chain OS=Plasmodium falciparum (isolate K1 / Thailand) PE=3 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 2.027e-41
Identity = 78/87 (89.66%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIP+N KSSVCDIPP+GL MA TF+GNST+IQEMF+RVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPHNTKSSVCDIPPKGLKMAVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PLAF7 (Tubulin beta chain OS=Plasmodium falciparum (isolate 3D7) GN=PF10_0084 PE=3 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 2.027e-41
Identity = 78/87 (89.66%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIP+N KSSVCDIPP+GL MA TF+GNST+IQEMF+RVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPHNTKSSVCDIPPKGLKMAVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ONCGI (Tubulin beta chain OS=Onchocerca gibsoni GN=TBB PE=3 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.647e-41
Identity = 78/87 (89.66%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK++VCDIPPR L MA+TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+A
Sbjct:  344 WIPNNVKTAVCDIPPRDLKMAATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_EIMTE (Tubulin beta chain OS=Eimeria tenella PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.647e-41
Identity = 77/87 (88.51%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+KS VCDIPP+GL M+ TF+GNST+IQEMF+RVS+QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNMKSGVCDIPPKGLKMSVTFVGNSTAIQEMFKRVSDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TRITR (Tubulin beta chain OS=Trichuris trichiura PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 76/86 (88.37%), Postives = 85/86 (98.84%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNVK++VCDIPPRGL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+AT
Sbjct:  344 WIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_DROME (Tubulin beta-2 chain OS=Drosophila melanogaster GN=betaTub85D PE=1 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 77/87 (88.51%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN K++VCDIPPRGL M++TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_DROHY (Tubulin beta-2 chain OS=Drosophila hydei GN=betaTub85D PE=2 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 77/87 (88.51%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN K++VCDIPPRGL M++TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_DROER (Tubulin beta-2 chain OS=Drosophila erecta GN=betaTub85D PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 77/87 (88.51%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN K++VCDIPPRGL M++TFIGNST+IQE+F+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+ATA
Sbjct:  344 WIPNNCKTAVCDIPPRGLKMSATFIGNSTAIQELFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB1_SOYBN (Tubulin beta-1 chain OS=Glycine max GN=TUBB1 PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 3.457e-41
Identity = 78/87 (89.66%), Postives = 83/87 (95.40%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVKSSVCDIPP GLSM+STF+GNSTSIQEMFRRVSEQFT MF+RKAFLHWYTGEGMDEMEFTE  +NMNDLV+EYQQYQDATA
Sbjct:  344 WIPNNVKSSVCDIPPTGLSMSSTFMGNSTSIQEMFRRVSEQFTVMFKRKAFLHWYTGEGMDEMEFTEVRANMNDLVAEYQQYQDATA 430          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB_TRYCR2.027e-4189.53Tubulin beta chain OS=Trypanosoma cruzi PE=3 SV=2[more]
TBB_PLAFK2.027e-4189.66Tubulin beta chain OS=Plasmodium falciparum (isola... [more]
TBB_PLAF72.027e-4189.66Tubulin beta chain OS=Plasmodium falciparum (isola... [more]
TBB_ONCGI2.647e-4189.66Tubulin beta chain OS=Onchocerca gibsoni GN=TBB PE... [more]
TBB_EIMTE2.647e-4188.51Tubulin beta chain OS=Eimeria tenella PE=2 SV=1[more]
TBB_TRITR3.457e-4188.37Tubulin beta chain OS=Trichuris trichiura PE=3 SV=... [more]
TBB2_DROME3.457e-4188.51Tubulin beta-2 chain OS=Drosophila melanogaster GN... [more]
TBB2_DROHY3.457e-4188.51Tubulin beta-2 chain OS=Drosophila hydei GN=betaTu... [more]
TBB2_DROER3.457e-4188.51Tubulin beta-2 chain OS=Drosophila erecta GN=betaT... [more]
TBB1_SOYBN3.457e-4189.66Tubulin beta-1 chain OS=Glycine max GN=TUBB1 PE=3 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top