DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB6_ECTVR (Tubulin beta-6 chain OS=Ectocarpus variabilis GN=TUBB6 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.314e-40
Identity = 74/87 (85.06%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK+S+CDIPP+GL M++TF+GN+T+IQE+++RV+EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKASICDIPPKGLKMSTTFVGNTTAIQEVWKRVAEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_GOSHI (Tubulin beta-3 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 1.314e-40
Identity = 79/81 (97.53%), Postives = 80/81 (98.77%), Query Frame = -3
Query:  452 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQ 694
            WIPNNVKSSVCDIPPRGLSMASTF+GNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS YQQ
Sbjct:  344 WIPNNVKSSVCDIPPRGLSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSGYQQ 424          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_BABBO (Tubulin beta chain OS=Babesia bovis PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.716e-40
Identity = 76/86 (88.37%), Postives = 83/86 (96.51%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIP+N KSSVCDIPP+GL MA TF+GNST+IQ+MF+RVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+AT
Sbjct:  344 WIPHNTKSSVCDIPPKGLKMAVTFVGNSTAIQDMFKRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB5_ECTVR (Tubulin beta-5 chain OS=Ectocarpus variabilis GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.927e-40
Identity = 73/87 (83.91%), Postives = 86/87 (98.85%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK+S+CDIPP+GL M++TF+GN+T+IQE+++RV+EQFT+MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKASICDIPPKGLKMSTTFVGNTTAIQEVWKRVAEQFTSMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB3_OOMCK (Tubulin beta-3 chain OS=Oomycete-like sp. (strain MacKay2000) GN=TUBB3 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.927e-40
Identity = 73/87 (83.91%), Postives = 85/87 (97.70%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNN+K+SVCDIPP+GL M+STF+GNST+IQEMF+RV EQFTAM++RKAFLHWYTGEGMD+MEFTEAESNMNDLVSEYQQYQ+A+A
Sbjct:  344 WIPNNIKASVCDIPPKGLKMSSTFVGNSTAIQEMFKRVGEQFTAMYKRKAFLHWYTGEGMDDMEFTEAESNMNDLVSEYQQYQEASA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_THAWE (Tubulin beta chain OS=Thalassiosira weissflogii PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.822e-40
Identity = 73/87 (83.91%), Postives = 84/87 (96.55%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            WIPNNVK+S+CDIPP+GL MA+TF+GN+T++QE ++RV+EQFT MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  344 WIPNNVKASICDIPPKGLKMATTFVGNTTAVQETWKRVAEQFTVMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_LEIME (Tubulin beta chain OS=Leishmania mexicana PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 3.822e-40
Identity = 75/86 (87.21%), Postives = 80/86 (93.02%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSS+CDIPP+GL M+ TFIGN+T IQEMFRRV EQFT MFRRK FLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Sbjct:  346 WIPNNIKSSICDIPPKGLKMSVTFIGNNTCIQEMFRRVGEQFTGMFRRKRFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 431          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ENTDO (Tubulin beta chain OS=Enteroctopus dofleini PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 8.516e-40
Identity = 74/85 (87.06%), Postives = 83/85 (97.65%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNVK++VCDIPP GL M++TFIGNST+IQE+F+R+SEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A
Sbjct:  344 WIPNNVKTAVCDIPPTGLEMSATFIGNSTAIQEIFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_GIBZE (Tubulin beta chain OS=Gibberella zeae GN=TUB2 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.112e-39
Identity = 74/85 (87.06%), Postives = 83/85 (97.65%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL+M+STFIGNSTSIQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRGLTMSSTFIGNSTSIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_GIBFU (Tubulin beta chain OS=Gibberella fujikuroi GN=TUB2 PE=3 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 1.112e-39
Identity = 74/85 (87.06%), Postives = 83/85 (97.65%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNN+++++C IPPRGL+M+STFIGNSTSIQE+F+RV EQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Sbjct:  344 WIPNNIQTALCAIPPRGLTMSSTFIGNSTSIQELFKRVGEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 428          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
TBB6_ECTVR1.314e-4085.06Tubulin beta-6 chain OS=Ectocarpus variabilis GN=T... [more]
TBB3_GOSHI1.314e-4097.53Tubulin beta-3 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB_BABBO1.716e-4088.37Tubulin beta chain OS=Babesia bovis PE=3 SV=1[more]
TBB5_ECTVR2.927e-4083.91Tubulin beta-5 chain OS=Ectocarpus variabilis GN=T... [more]
TBB3_OOMCK2.927e-4083.91Tubulin beta-3 chain OS=Oomycete-like sp. (strain ... [more]
TBB_THAWE3.822e-4083.91Tubulin beta chain OS=Thalassiosira weissflogii PE... [more]
TBB_LEIME3.822e-4087.21Tubulin beta chain OS=Leishmania mexicana PE=3 SV=... [more]
TBB_ENTDO8.516e-4087.06Tubulin beta chain OS=Enteroctopus dofleini PE=2 S... [more]
TBB_GIBZE1.112e-3987.06Tubulin beta chain OS=Gibberella zeae GN=TUB2 PE=3... [more]
TBB_GIBFU1.112e-3987.06Tubulin beta chain OS=Gibberella fujikuroi GN=TUB2... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top