DN617298

Overview
NameDN617298
Unique NameDN617298
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length696
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9861 contig Csv1_Contig9861:1101..1793. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: YI016_HUMAN (Putative tubulin beta chain-like protein ENSP00000290377 OS=Homo sapiens PE=5 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.097e-38
Identity = 72/87 (82.76%), Postives = 82/87 (94.25%), Query Frame = -3
Query:  434 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 694
            W P+NVK+++CDIPPRGL M+++FIGN+ +IQE+F  VSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA
Sbjct:  272 WFPDNVKTAICDIPPRGLKMSASFIGNNAAIQELFTCVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATA 358          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PENDI (Tubulin beta chain OS=Penicillium digitatum GN=TUB2 PE=3 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 2.097e-38
Identity = 70/86 (81.40%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C +PPRGL M+STF+GNSTSIQE+F+RV +QF AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNVQTALCSVPPRGLKMSSTFVGNSTSIQELFKRVGDQFAAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_EMENI (Tubulin beta-2 chain OS=Emericella nidulans GN=tubC PE=3 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.097e-38
Identity = 70/86 (81.40%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C +PP+GL MA+TF+GNSTS+QE+F RVS QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDL+SEYQQYQ+AT
Sbjct:  344 WIPNNVQTALCSMPPKGLKMAATFVGNSTSVQELFNRVSNQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLMSEYQQYQEAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_AJECA (Tubulin beta chain OS=Ajellomyces capsulata GN=TUB2 PE=3 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.739e-38
Identity = 71/86 (82.56%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+ NST+IQE+F+RV +QFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  345 WIPNNVQTALCSIPPRGLKMSSTFVENSTAIQELFKRVGDQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 430          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB2_PHYPO (Tubulin beta-2 chain OS=Physarum polycephalum GN=BETC PE=2 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 2.739e-38
Identity = 70/86 (81.40%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNN+KSSVCDIPP+G+ M++TFIGN+T IQE+F+R+  QF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQ+A+
Sbjct:  344 WIPNNIKSSVCDIPPKGMKMSATFIGNNTCIQELFKRIGLQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQEAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_RHYSE (Tubulin beta chain OS=Rhynchosporium secalis PE=3 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.578e-38
Identity = 70/86 (81.40%), Postives = 81/86 (94.19%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIP NV++++C IPPRGL M+STF+GNSTSIQE+F+R+ +QFT MFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA+
Sbjct:  344 WIPTNVQTALCSIPPRGLKMSSTFVGNSTSIQELFKRIGDQFTRMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_TRIRU (Tubulin beta chain OS=Trichophyton rubrum PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 7.970e-38
Identity = 70/86 (81.40%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIPNNV++++C IPPRGL M+STF+GNSTSIQE+F+RV +QFTAMFR+KAFL WYTGEGMDEMEFTEAE+NMNDLVSEYQQYQDA+
Sbjct:  344 WIPNNVQTALCSIPPRGLQMSSTFVGNSTSIQELFKRVGDQFTAMFRKKAFLFWYTGEGMDEMEFTEAENNMNDLVSEYQQYQDAS 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_PNECA (Tubulin beta chain OS=Pneumocystis carinii GN=TUB-B PE=2 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.041e-37
Identity = 71/85 (83.53%), Postives = 81/85 (95.29%), Query Frame = -3
Query:  440 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA 694
            WIPNNV++++C IPPRGL M+STFIGNSTSIQE+F+RV +QF+AMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQY+ A
Sbjct:  344 WIPNNVQTALCSIPPRGLKMSSTFIGNSTSIQELFKRVGDQFSAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYEIA 428          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ENCIN (Tubulin beta chain OS=Encephalitozoon intestinalis GN=TUB2 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.041e-37
Identity = 69/86 (80.23%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIP+NVK++VCDI P GL M++TF+GN+TSIQE+F+R+S+QFT MFRRKAFLHWYTGEGMDEMEF+EAESNMNDL+SEYQQYQDAT
Sbjct:  344 WIPSNVKTAVCDIAPTGLEMSATFVGNTTSIQELFKRISDQFTVMFRRKAFLHWYTGEGMDEMEFSEAESNMNDLLSEYQQYQDAT 429          
BLAST of DN617298 vs. ExPASy Swiss-Prot
Match: TBB_ENCHE (Tubulin beta chain OS=Encephalitozoon hellem GN=TUB2 PE=3 SV=1)

HSP 1 Score: 156.762 bits (395), Expect = 1.041e-37
Identity = 69/86 (80.23%), Postives = 82/86 (95.35%), Query Frame = -3
Query:  437 WIPNNVKSSVCDIPPRGLSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT 694
            WIP+NVK++VCDI P GL M++TF+GN+TSIQE+F+R+S+QFT MFRRKAFLHWYTGEGMDEMEF+EAESNMNDL+SEYQQYQDAT
Sbjct:  344 WIPSNVKTAVCDIAPTGLEMSATFVGNTTSIQELFKRISDQFTVMFRRKAFLHWYTGEGMDEMEFSEAESNMNDLLSEYQQYQDAT 429          
The following BLAST results are available for this feature:
BLAST of DN617298 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 258
Match NameE-valueIdentityDescription
YI016_HUMAN2.097e-3882.76Putative tubulin beta chain-like protein ENSP00000... [more]
TBB_PENDI2.097e-3881.40Tubulin beta chain OS=Penicillium digitatum GN=TUB... [more]
TBB2_EMENI2.097e-3881.40Tubulin beta-2 chain OS=Emericella nidulans GN=tub... [more]
TBB_AJECA2.739e-3882.56Tubulin beta chain OS=Ajellomyces capsulata GN=TUB... [more]
TBB2_PHYPO2.739e-3881.40Tubulin beta-2 chain OS=Physarum polycephalum GN=B... [more]
TBB_RHYSE3.578e-3881.40Tubulin beta chain OS=Rhynchosporium secalis PE=3 ... [more]
TBB_TRIRU7.970e-3881.40Tubulin beta chain OS=Trichophyton rubrum PE=2 SV=... [more]
TBB_PNECA1.041e-3783.53Tubulin beta chain OS=Pneumocystis carinii GN=TUB-... [more]
TBB_ENCIN1.041e-3780.23Tubulin beta chain OS=Encephalitozoon intestinalis... [more]
TBB_ENCHE1.041e-3780.23Tubulin beta chain OS=Encephalitozoon hellem GN=TU... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS11_01A09_r Parent Washington Navel Orange Scale-Infested Rind cDNA Library UCRCS11 Citrus sinensis cDNA clone CS_WEd0001A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DN617298 ID=DN617298|Name=DN617298|organism=Citrus sinensis|type=EST|length=696bp
TTTTTTTTTCCAAGGAAAAGAAATAGCATATCACATTATGGCATAATAGA
CAGTAACATAATAACATCATCGACCACAGAACATAAGAAGACAATGGCTA
AGGATAATAGAATACAAAAATAGATCAAATCCAGAATAGATAGCAAGGTA
AAGGTAGCACACACTACTACTTTCAAAACATGCATCCATCCTTTAATTTC
TCCATCCTCAATAGTCGATCCTCATCGATCCCATCATCCATCACTCACTT
TACTGCTACTTGATGTAAAAAACTCGAGAAAGAAAAACTATAACACATCA
TAGATCATTTTTTGCAATCCCAAGCAAGGTTGACAAAACCAGCTACACAG
ACAAATATGCATCATACACAACTTCTTCAAATATGATGCTCCAATTCTCC
CTCTTCCTCATCTTCATACTCGCCTTCCTCATCGGCGGTGGCATCCTGGT
ACTGCTGGTACTCAGACACGAGGTCATTCATATTGCTCTCAGCTTCAGTG
AACTCCATTTCATCCATCCCTTCACCAGTGTACCAGTGAAGGAAAGCCTT
TCTCCTAAACATAGCTGTGAATTGCTCACTCACTCTTCGGAACATTTCTT
GGATGGATGTTGAGTTCCCGATGAAGGTGGATGCCATGGAGAGACCTCTG
GGAGGAATGTCACAAACACTGGACTTCACATTGTTTGGAATCCACT
back to top