DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP_TRYBB (Cysteine proteinase OS=Trypanosoma brucei brucei PE=1 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 7.058e-23
Identity = 54/129 (41.86%), Postives = 75/129 (58.14%), Query Frame = 1
Query:   55 SSYPYI---GKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMN 432
            +SYPY+   G++ +CQ +  +I   + +  ++P DE+ IAA+L  +GPLAI ++A     Y GG+     C  K L+HGVLLVGY           N PYWIIKNSW   WG+ GY R+ +G   C MN
Sbjct:  212 ASYPYVSGNGEQPQCQMNGHEIGAAITDHVDLPQDEDAIAAYLAENGPLAIAVDAESFMDYNGGILTS--CTSKQLDHGVLLVGYNDNS-------NPPYWIIKNSWSNMWGEDGYIRIEKGTNQCLMN 331          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: LMCPA_LEIME (Cysteine proteinase A OS=Leishmania mexicana GN=LMCPA PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 6.183e-19
Identity = 53/142 (37.32%), Postives = 73/142 (51.41%), Query Frame = 1
Query:    7 LMTMHPILIATEG*XXSSYPYI---GKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMC 423
            +M  H   + TE    +SYPY    G R  C  D  ++  ++  F ++P DE +IA  +   GP+A+ ++A   Q Y GGV    +C    LNHGVL+VG+             PYWI+KNSWG  WG+ GY RL  G   C
Sbjct:  203 IMQSHNGSVFTE----ASYPYTSGGGTRPPCH-DEGEVGAKITGFLSLPHDEERIAEWVEKRGPVAVAVDATTWQLYFGGVVS--LCLAWSLNHGVLIVGFNKNA-------KPPYWIVKNSWGSSWGEKGYIRLAMGSNQC 330          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP1_LEIPI (Cysteine proteinase 1 OS=Leishmania pifanoi GN=CYS1 PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 6.183e-19
Identity = 53/142 (37.32%), Postives = 73/142 (51.41%), Query Frame = 1
Query:    7 LMTMHPILIATEG*XXSSYPYI---GKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMC 423
            +M  H   + TE    +SYPY    G R  C  D  ++  ++  F ++P DE +IA  +   GP+A+ ++A   Q Y GGV    +C    LNHGVL+VG+             PYWI+KNSWG  WG+ GY RL  G   C
Sbjct:  203 IMQSHNGSVFTE----ASYPYTSGGGTRPPCH-DEGEVGAKITGFLSLPHDEERIAEWVEKRGPVAVAVDATTWQLYFGGVVS--LCLAWSLNHGVLIVGFNKNA-------KPPYWIVKNSWGSSWGEKGYIRLAMGSNQC 330          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP_TRYCR (Cruzipain OS=Trypanosoma cruzi PE=1 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.076e-19
Identity = 50/125 (40.00%), Postives = 63/125 (50.40%), Query Frame = 1
Query:   58 SYPYIGKRG---KCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMC 423
            SYPY    G    C      +   +     +P DE QIAA L  +GP+A+ ++A    TY GGV     C  + L+HGVLLVGY             PYWIIKNSW  QWG+ GY R+ +G   C
Sbjct:  210 SYPYASGEGISPPCTTSGHTVGATITGHVELPQDEAQIAAWLAVNGPVAVAVDASSWMTYTGGVMTS--CVSEQLDHGVLLVGYNDSAAV-------PYWIIKNSWTTQWGEEGYIRIAKGSNQC 325          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVAH (Viral cathepsin OS=Adoxophyes honmai nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 8.076e-19
Identity = 48/125 (38.40%), Postives = 70/125 (56.00%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTN-IPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMN 432
            YPY G +G C+ D++K A+ V++    I  +E  +   L+  GP+A+ ++A  + TY  G+     C    LNH VLLVGYG +G          YW +KNSWG  WG+ GY+R+ R    CG+N
Sbjct:  212 YPYQGTKGVCKIDNKKFALSVSSCKRYIFQNEENLKKELITMGPIAMAIDAASISTYSKGIIH--FCENLGLNHAVLLVGYGTEG-------GVSYWTLKNSWGSDWGEDGYFRVKRNINACGLN 327          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATW_MOUSE (Cathepsin W OS=Mus musculus GN=Ctsw PE=2 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.055e-18
Identity = 51/137 (37.23%), Postives = 72/137 (52.55%), Query Frame = 1
Query:   61 YPYIGKRG--KCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGV--SCPLICGKKWLNHGVLLVGYGAK----------GFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YP+ G R   +C     K    + +FT +  +E  IA +L  HGP+ + +N   +Q Y  GV  + P  C  + ++H VLLVG+G K            S  R  + PYWI+KNSWG  WG+ GY+RL RG   CG+
Sbjct:  213 YPFQGDRKPHRCLAKKYKKVAWIQDFTMLSNNEQAIAHYLAVHGPITVTINMKLLQHYQKGVIKATPSSCDPRQVDHSVLLVGFGKKKEGMQTGTVLSHSRKRRHSSPYWILKNSWGAHWGEKGYFRLYRGNNTCGV 349          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVMC (Viral cathepsin OS=Mamestra configurata nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 1.055e-18
Identity = 52/124 (41.94%), Postives = 67/124 (54.03%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YPY   R  C     K AV V N +  + + E ++   L H GP+AI ++A+ +  Y GGV     C    LNH VLLVGYG +        N PYW IKNSWG  +G++GY R+ RG   CGM
Sbjct:  212 YPYKAVRLPCAVKPHKFAVGVRNCYRYVLLSEERLEDLLRHVGPIAIAVDAVDLTDYYGGVIS--FCENNGLNHAVLLVGYGIEN-------NVPYWTIKNSWGSDYGENGYVRIRRGVNSCGM 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATR_MOUSE (Cathepsin R OS=Mus musculus GN=Ctsr PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.350e-18
Identity = 45/128 (35.16%), Postives = 71/128 (55.47%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            ++YPY GK G C+++ +     +  F ++P  E+ + A +   GP+  G++A     + Y GG+     C    + HGVL+VGYG KG   +      YW+IKNSWGK+WG  GY +L + +   CG+
Sbjct:  201 ATYPYEGKDGPCRYNPKNSKAEITGFVSLPQSEDILMAAVATIGPITAGIDASHESFKNYKGGIYHEPNCSSDTVTHGVLVVGYGFKG---IETDGNHYWLIKNSWGKRWGIRGYMKLAKDKNNHCGI 325          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVST (Viral cathepsin OS=Spodoptera litura multicapsid nucleopolyhedrovirus GN=VCATH PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.069e-18
Identity = 46/124 (37.10%), Postives = 69/124 (55.65%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YPY G    C+    K+AVR+++     + DE ++   L  +GP+A+ ++ + +  Y  G++   +C    LNH VLLVGYG +        + PYWI KNSWG  WG++GY+R  R    CGM
Sbjct:  212 YPYQGIEYACRLAPSKLAVRLSHCYQYDLRDERKLLELLYKNGPIAVAIDCVDIIDYRSGIAT--VCNDNGLNHAVLLVGYGIEN-------DTPYWIFKNSWGSNWGENGYFRARRNINACGM 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ALEU_ARATH (Thiol protease aleurain OS=Arabidopsis thaliana GN=ALEU PE=1 SV=2)

HSP 1 Score: 91.6633 bits (226), Expect = 4.008e-18
Identity = 53/132 (40.15%), Postives = 71/132 (53.79%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV---DENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGKKWL--NHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            +YPY GK   C+F +E + V+V N  NI +   DE + A  LV   P++I    I   + Y  GV     CG   +  NH VL VGYG +          PYW+IKNSWG  WGD GY+++  G+ MCG+ T
Sbjct:  228 AYPYTGKDETCKFSAENVGVQVLNSVNITLGAEDELKHAVGLVR--PVSIAFEVIHSFRLYKSGVYTDSHCGSTPMDVNHAVLAVGYGVED-------GVPYWLIKNSWGADWGDKGYFKMEMGKNMCGIAT 350          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CYSP_TRYBB7.058e-2341.86Cysteine proteinase OS=Trypanosoma brucei brucei P... [more]
LMCPA_LEIME6.183e-1937.32Cysteine proteinase A OS=Leishmania mexicana GN=LM... [more]
CYSP1_LEIPI6.183e-1937.32Cysteine proteinase 1 OS=Leishmania pifanoi GN=CYS... [more]
CYSP_TRYCR8.076e-1940.00Cruzipain OS=Trypanosoma cruzi PE=1 SV=1[more]
CATV_NPVAH8.076e-1938.40Viral cathepsin OS=Adoxophyes honmai nucleopolyhed... [more]
CATW_MOUSE1.055e-1837.23Cathepsin W OS=Mus musculus GN=Ctsw PE=2 SV=1[more]
CATV_NPVMC1.055e-1841.94Viral cathepsin OS=Mamestra configurata nucleopoly... [more]
CATR_MOUSE2.350e-1835.16Cathepsin R OS=Mus musculus GN=Ctsr PE=2 SV=1[more]
CATV_NPVST3.069e-1837.10Viral cathepsin OS=Spodoptera litura multicapsid n... [more]
ALEU_ARATH4.008e-1840.15Thiol protease aleurain OS=Arabidopsis thaliana GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top