DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATJ_RAT (Cathepsin J OS=Rattus norvegicus GN=Ctsj PE=2 SV=2)

HSP 1 Score: 87.4261 bits (215), Expect = 7.559e-17
Identity = 44/128 (34.38%), Postives = 71/128 (55.47%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            ++YPY GK G C++ SE  +  +  F N+P +E  +   +   GP++  ++A     + Y GGV     C    +NH VL+VGYG +G          YW+IKNSWG++WG +G+ ++ + R   CG+
Sbjct:  200 ATYPYEGKDGPCRYHSENASANITGFVNLPPNELYLWVAVASIGPVSAAIDASHDSFRFYSGGVYHEPNCSSYVVNHAVLVVGYGFEG---NETDGNNYWLIKNSWGEEWGINGFMKIAKDRNNHCGI 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ORYC_ORYSJ (Oryzain gamma chain OS=Oryza sativa subsp. japonica GN=Os09g0442300 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 9.872e-17
Identity = 50/132 (37.88%), Postives = 70/132 (53.03%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV---DENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGKKWL--NHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            +YPY G  G C +  E + V+V +  NI +   DE + A  LV   P+++    I   + Y  GV     CG   +  NH VL VGYG +          PYW+IKNSWG  WGD+GY+++  G+ MCG+ T
Sbjct:  232 AYPYTGVNGICHYKPENVGVKVLDSVNITLGAEDELKNAVGLVR--PVSVAFQVINGFRMYKSGVYTSDHCGTSPMDVNHAVLAVGYGVEN-------GVPYWLIKNSWGADWGDNGYFKMEMGKNMCGIAT 354          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVHZ (Viral cathepsin OS=Heliothis zea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.872e-17
Identity = 47/126 (37.30%), Postives = 71/126 (56.35%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            + YPY G    C  D+ KIAV++ +     + DEN++   +   GP+AI ++A+ +  Y  G+     C    LNH VLL+G+G +        N PYWIIKNSWG+ WG++G+ R+ R    CG+
Sbjct:  240 ADYPYQGSEQMCTLDNRKIAVKLNSCFKYDIRDENKLKELVYTTGPVAIAVDAMDIINYRRGILNQ--CHIYDLNHAVLLIGWGIEN-------NVPYWIIKNSWGEDWGENGFLRVRRNVNACGL 356          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATH_MOUSE (Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.872e-17
Identity = 49/129 (37.98%), Postives = 69/129 (53.49%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAI--FMQTYIGGVSCPLICGKK--WLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            SYPYIGK   C+F+ +K    V N  NI + DE  +   +  + P++        F+  Y  GV     C K    +NH VL VGYG +   +       YWI+KNSWG QWG++GY+ + RG+ MCG+
Sbjct:  202 SYPYIGKDSSCRFNPQKAVAFVKNVVNITLNDEAAMVEAVALYNPVSFAFEVTEDFLM-YKSGVYSSKSCHKTPDKVNHAVLAVGYGEQNGLL-------YWIVKNSWGSQWGENGYFLIERGKNMCGL 322          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_CANFA (Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.289e-16
Identity = 46/129 (35.66%), Postives = 73/129 (56.59%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYI--GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGM 429
            +SYPY    GKC++DS+K A   + +T +P   E+ +   + + GP+++ ++A     ++   GV     C +  +NHGVL+VGYG        L  + YW++KNSWG  +GD GY R+ R  G  CG+
Sbjct:  202 ASYPYKAMNGKCRYDSKKRAATCSKYTELPFGSEDALKEAVANKGPVSVAIDASHYSFFLYRSGVYYEPSCTQN-VNHGVLVVGYG-------NLNGKDYWLVKNSWGLNFGDQGYIRMARNSGNHCGI 322          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: LMCPB_LEIME (Cysteine proteinase B OS=Leishmania mexicana GN=LMCPB PE=2 SV=2)

HSP 1 Score: 86.2705 bits (212), Expect = 1.684e-16
Identity = 51/126 (40.48%), Postives = 64/126 (50.79%), Query Frame = 1
Query:   58 SYPYIGKRG---KCQFDSEKIA-VRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMC 423
            SYPY+   G   +C   SE +   ++     I   E  +AA L  +GP+AI L+A    +Y  GV     C  K LNHGVLLVGY   G         PYW+IKNSWG  WG+ GY R+  G   C
Sbjct:  213 SYPYVSGNGYVPECSNSSELVVGAQIDGHVLIGSSEKAMAAWLAKNGPIAIALDASSFMSYKSGVLTA--CIGKQLNHGVLLVGYDMTG-------EVPYWVIKNSWGGDWGEQGYVRVVMGVNAC 329          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSP2_HOMAM (Digestive cysteine proteinase 2 OS=Homarus americanus GN=LCP2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.684e-16
Identity = 46/132 (34.85%), Postives = 70/132 (53.03%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNTM 438
            ++YPY  + G C+FDS  +A   +  TNI    E  +   +   GP+++ ++A     Q Y  GV     C   +L+H VL VGYG++G        Q +W++KNSW   WGD GY ++ R R   CG+ T+
Sbjct:  193 AAYPYEARDGSCRFDSNSVAATCSGHTNIASGSETGLQQAVRDIGPISVTIDAAHSSFQFYSSGVYYEPSCSPSYLDHAVLAVGYGSEG-------GQDFWLVKNSWATSWGDAGYIKMSRNRNNNCGIATV 317          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATW_HUMAN (Cathepsin W OS=Homo sapiens GN=CTSW PE=1 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 2.872e-16
Identity = 48/140 (34.29%), Postives = 76/140 (54.29%), Query Frame = 1
Query:   61 YPYIGK--RGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGV--SCPLICGKKWLNHGVLLVGYGA----KGFSILRLGNQ---------PYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YP+ GK    +C     +    + +F  +  +E++IA +L  +GP+ + +N   +Q Y  GV  + P  C  + ++H VLLVG+G+    +G     + +Q         PYWI+KNSWG QWG+ GY+RL RG   CG+
Sbjct:  215 YPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGI 354          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVHC (Viral cathepsin OS=Hyphantria cunea nuclear polyhedrosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.751e-16
Identity = 45/126 (35.71%), Postives = 66/126 (52.38%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVAN-FTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            + YPY G  G C+ D  K  V+V   +  I V E ++   L   GP+ + ++A  +  Y  G+     C     NH VLLVGYG +        N PYWI+KN+WG+ WG+ GY+R+ +    CG+
Sbjct:  197 NDYPYEGSDGNCRVDVAKFVVKVKKCYRYIAVFEEKLKDLLRIVGPIPVAIDASDIVNYRRGIM--RYCSNYGFNHAVLLVGYGVEN-------NVPYWILKNTWGEDWGEQGYFRVQQNINACGI 313          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ALEU_HORVU (Thiol protease aleurain OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 3.751e-16
Identity = 51/132 (38.64%), Postives = 70/132 (53.03%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV---DENQIAAHLVHHGPLAIGLNAIF-MQTYIGGVSCPLICGKKW--LNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGMNT 435
            SYPY G  G C + +E  AV+V +  NI +   DE + A  LV   P+++    I   + Y  GV     CG     +NH VL VGYG +          PYW+IKNSWG  WGD+GY+++  G+ MC + T
Sbjct:  231 SYPYKGVNGVCHYKAENAAVQVLDSVNITLNAEDELKNAVGLVR--PVSVAFQVIDGFRQYKSGVYTSDHCGTTPDDVNHAVLAVGYGVEN-------GVPYWLIKNSWGADWGDNGYFKMEMGKNMCAIAT 353          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATJ_RAT7.559e-1734.38Cathepsin J OS=Rattus norvegicus GN=Ctsj PE=2 SV=2[more]
ORYC_ORYSJ9.872e-1737.88Oryzain gamma chain OS=Oryza sativa subsp. japonic... [more]
CATV_NPVHZ9.872e-1737.30Viral cathepsin OS=Heliothis zea nuclear polyhedro... [more]
CATH_MOUSE9.872e-1737.98Cathepsin H OS=Mus musculus GN=Ctsh PE=2 SV=1[more]
CATS_CANFA1.289e-1635.66Cathepsin S OS=Canis familiaris GN=CTSS PE=2 SV=1[more]
LMCPB_LEIME1.684e-1640.48Cysteine proteinase B OS=Leishmania mexicana GN=LM... [more]
CYSP2_HOMAM1.684e-1634.85Digestive cysteine proteinase 2 OS=Homarus america... [more]
CATW_HUMAN2.872e-1634.29Cathepsin W OS=Homo sapiens GN=CTSW PE=1 SV=2[more]
CATV_NPVHC3.751e-1635.71Viral cathepsin OS=Hyphantria cunea nuclear polyhe... [more]
ALEU_HORVU3.751e-1638.64Thiol protease aleurain OS=Hordeum vulgare PE=2 SV... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top