DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_BOVIN (Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2)

HSP 1 Score: 81.6481 bits (200), Expect = 4.148e-15
Identity = 45/129 (34.88%), Postives = 70/129 (54.26%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQTYI--GGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGM 429
            +SYPY    GKCQ+D +  A   + +  +P   E  +   + + GP+++G++A     ++   GV     C +  +NHGVL+VGYG        L  + YW++KNSWG  +GD GY R+ R  G  CG+
Sbjct:  202 ASYPYKAMDGKCQYDVKNRAATCSRYIELPFGSEEALKEAVANKGPVSVGIDASHSSFFLYKTGVYYDPSCTQN-VNHGVLVVGYG-------NLDGKDYWLVKNSWGLHFGDQGYIRMARNSGNHCGI 322          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATH_BOVIN (Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 4.148e-15
Identity = 50/130 (38.46%), Postives = 67/130 (51.54%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPL--AIGLNAIFMQTYIGGVSCPLICGKK--WLNHGVLLVGYGA-KGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            +YPY G+ G C++   K    V +  NI + DE  +   +  H P+  A  + A FM  Y  G+     C K    +NH VL VGYG  KG         PYWI+KNSWG  WG  GY+ + RG+ MCG+
Sbjct:  204 TYPYRGQDGDCKYQPSKAIAFVKDVANITLNDEEAMVEAVALHNPVSFAFEVTADFMM-YRKGIYSSTSCHKTPDKVNHAVLAVGYGEEKGI--------PYWIVKNSWGPNWGMKGYFLIERGKNMCGL 324          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL1_CANFA (Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.417e-15
Identity = 44/130 (33.85%), Postives = 70/130 (53.85%), Query Frame = 1
Query:   58 SYPYIGKRGK-CQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFM--QTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY+G+  + C +  E  A     F ++P  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G       N  +WI+KNSWG +WG +GY ++ + +   CG+ T
Sbjct:  201 SYPYLGRDTETCNYKPECSAANDTGFVDLPQREKALMKAVATLGPISVAIDAGHQSFQFYKSGIYFDPDCSSKDLDHGVLVVGYGFEGTD----SNNKFWIVKNSWGPEWGWNGYVKMAKDQNNHCGIAT 326          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_RAT (Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 5.417e-15
Identity = 45/131 (34.35%), Postives = 71/131 (54.20%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNTM 438
            +YPY+G+   C +++   A +   +  IPV +E  +   +   GP+++ ++A     Q Y  GV     C +  +NH VL+VGYG +       GN+ YWIIKNSWG+ WG+ GY  L R +   CG+  +
Sbjct:  200 AYPYVGQDESCMYNATAKAAKCRGYREIPVGNEKALKRAVARVGPVSVSIDASLTSFQFYSRGVYYDENCDRDNVNHAVLVVGYGTQK------GNK-YWIIKNSWGESWGNKGYVLLARNKNNACGITNL 323          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATW_FELCA (Cathepsin W OS=Felis catus GN=CTSW PE=2 SV=2)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 46/138 (33.33%), Postives = 69/138 (50.00%), Query Frame = 1
Query:   61 YPYIG--KRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGV--SCPLICGKKWLNHGVLLVGYG-----------AKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YP+ G  K  +C          + +F  +P +E +IA +L   GP+ + +N   ++ Y  GV  + P  C    ++H VLLVG+G           A G       + P+WI+KNSWG +WG  GY+RL RG   CG+
Sbjct:  215 YPFQGQVKPHRCLAKKRTKVAWIQDFIMLPDNEQKIAWYLATQGPITVTINMKLLKLYKKGVIEATPTSCDPFLVDHSVLLVGFGKSESVADRRAGAAGAQPQSRRSIPFWILKNSWGTKWGXGGYFRLYRGNNTCGI 352          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_NPVLD (Viral cathepsin OS=Lymantria dispar multicapsid nuclear polyhedrosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 7.075e-15
Identity = 41/125 (32.80%), Postives = 65/125 (52.00%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEK--IAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YP++G+  +C  D  +  +   V  +  + V+E ++   L   GP+ + ++A  +  Y  GV     C    LNH VLLVGYG +          PYW+ KN+WG  WG++GY+R+ +    CGM
Sbjct:  230 YPFVGRNRRCGLDRHRPYVVSLVGCYRYVMVNEEKLKDLLRAVGPIPMAIDAADIVNYYRGVISS--CENNGLNHAVLLVGYGVEN-------GVPYWVFKNTWGDDWGENGYFRVRQNVNACGM 345          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL_SARPE (Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.240e-15
Identity = 45/130 (34.62%), Postives = 66/130 (50.77%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY G    C F+   I      F +IP  DE ++   +   GP+++ ++A     Q Y  GV     C ++ L+HGVL+VGYG             YW++KNSWG  WG+ GY ++ R +   CG+ T
Sbjct:  209 SYPYEGIDDSCHFNKATIGATDTGFVDIPEGDEEKMKKAVATMGPVSVAIDASHESFQLYSEGVYNEPECDEQNLDHGVLVVGYGTDE------SGMDYWLVKNSWGTTWGEQGYIKMARNQNNQCGIAT 332          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATLL_FASHE (Cathepsin L-like proteinase OS=Fasciola hepatica GN=Cat-1 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.207e-14
Identity = 44/132 (33.33%), Postives = 66/132 (50.00%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLV---HHGPLAIGLNAIFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRG-MCGMNTM 438
            SSYPY    G+C+++ +    +V  +  +         +LV       +A+ + + FM  Y  G+     C    +NH VL VGYG +G          YWI+KNSWG  WG+ GY R+ R RG MCG+ ++
Sbjct:  193 SSYPYTAVEGQCRYNKQLGVAKVTGYYTVHSGSEVELKNLVGARRPAAVAVDVESDFMM-YRSGIYQSQTCSPLRVNHAVLAVGYGTQG-------GTDYWIVKNSWGTYWGERGYIRMARNRGNMCGIASL 316          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATQ_RAT (Cathepsin Q OS=Rattus norvegicus GN=Ctsq PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 43/122 (35.25%), Postives = 69/122 (56.56%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR 414
            ++YPY  K G C+++ +  + ++  F  +P  E+ +   +   GP+A G++ I    + Y  GV     C   ++NH VL+VGYG +G      GN  YW+IKNSWGK+WG  GY ++ + R
Sbjct:  211 ATYPYERKEGVCRYNPKNSSAKITGFVVLPESEDVLMDAVATKGPIATGVHVISSSFRFYQKGVYHEPKCSS-YVNHAVLVVGYGFEGNETD--GNN-YWLIKNSWGKRWGLRGYMKIAKDR 328          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATL2_HUMAN (Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 1.576e-14
Identity = 43/130 (33.08%), Postives = 68/130 (52.31%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNI-PVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGMNT 435
            SYPY+     C++  E        FT + P  E  +   +   GP+++ ++A     Q Y  G+     C  K L+HGVL+VGYG +G +     N  YW++KNSWG +WG +GY ++ + +   CG+ T
Sbjct:  201 SYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANS---NNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIAT 327          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATS_BOVIN4.148e-1534.88Cathepsin S OS=Bos taurus GN=CTSS PE=1 SV=2[more]
CATH_BOVIN4.148e-1538.46Cathepsin H OS=Bos taurus GN=CTSH PE=2 SV=1[more]
CATL1_CANFA5.417e-1533.85Cathepsin L1 OS=Canis familiaris GN=CTSL1 PE=2 SV=... [more]
CATK_RAT5.417e-1534.35Cathepsin K OS=Rattus norvegicus GN=Ctsk PE=2 SV=1[more]
CATW_FELCA7.075e-1533.33Cathepsin W OS=Felis catus GN=CTSW PE=2 SV=2[more]
CATV_NPVLD7.075e-1532.80Viral cathepsin OS=Lymantria dispar multicapsid nu... [more]
CATL_SARPE9.240e-1534.62Cathepsin L OS=Sarcophaga peregrina PE=1 SV=1[more]
CATLL_FASHE1.207e-1433.33Cathepsin L-like proteinase OS=Fasciola hepatica G... [more]
CATQ_RAT1.576e-1435.25Cathepsin Q OS=Rattus norvegicus GN=Ctsq PE=2 SV=1[more]
CATL2_HUMAN1.576e-1433.08Cathepsin L2 OS=Homo sapiens GN=CTSL2 PE=1 SV=2[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top