DC900408

Overview
NameDC900408
Unique NameDC900408
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length684
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4114 contig Csv1_Contig4114:85..768. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATS_RAT (Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.070e-13
Identity = 43/130 (33.08%), Postives = 67/130 (51.54%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIFMQT---YIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCR-GRGMCGM 429
            +SYPY     KC +D +  A   + +  +P  DE  +   +   GP+++G++     +   Y  GV     C +  +NHGVL+VGYG        L  + YW++KNSWG  +GD GY R+ R  +  CG+
Sbjct:  200 ASYPYKAMDEKCLYDPKNRAATCSRYIELPFGDEEALKEAVATKGPVSVGIDDASHSSFFLYQSGVYDDPSCTEN-MNHGVLVVGYGT-------LDGKDYWLVKNSWGLHFGDQGYIRMARNNKNHCGI 321          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CYSEP_VIGMU (Vignain OS=Vigna mungo PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.622e-13
Identity = 47/137 (34.31%), Postives = 69/137 (50.36%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKI---AVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGMNTM 438
            S+YPY  + G C  D  K+   AV +    N+PV++       V + P+++ ++A     Q Y  GV     C    LNHGV +VGYG        +    YWI++NSWG +WG+ GY R+ R      G+CG+  M
Sbjct:  213 SNYPYTAQEGTC--DESKVNDLAVSIDGHENVPVNDENALLKAVANQPVSVAIDAGGSDFQFYSEGVFTG-DCNTD-LNHGVAIVGYGTT------VDGTNYWIVRNSWGPEWGEQGYIRMQRNISKKEGLCGIAMM 339          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_RABIT (Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.648e-13
Identity = 42/128 (32.81%), Postives = 67/128 (52.34%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    +NH VL VGYG      ++ GN+ +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  200 AYPYVGQDESCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCSSDNVNHAVLAVGYG------IQKGNK-HWIIKNSWGESWGNKGYILMARNKNNACGI 320          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ACTN_ACTCH (Actinidain OS=Actinidia chinensis PE=1 SV=4)

HSP 1 Score: 73.559 bits (179), Expect = 1.129e-12
Identity = 47/135 (34.81%), Postives = 69/135 (51.11%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFD--SEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAI---FMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCR---GRGMCGMNTM 438
            +YPY  + G+C  D  +EK  V +  + N+P +        V + P+++ L+A    F Q   G  + P  CG   ++H V +VGYG +G          YWI+KNSW   WG+ GY R+ R   G G CG+ TM
Sbjct:  214 NYPYTAQDGECNVDLQNEKY-VTIDTYENVPYNNEWALQTAVTYQPVSVALDAAGDAFKQYSSGIFTGP--CGTA-VDHAVTIVGYGTEG-------GIDYWIVKNSWDTTWGEEGYMRILRNVGGAGTCGIATM 337          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: XCP1_ARATH (Xylem cysteine proteinase 1 OS=Arabidopsis thaliana GN=XCP1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.475e-12
Identity = 45/133 (33.83%), Postives = 71/133 (53.38%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIA-VRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGMNTM 438
            YPY+ + G CQ   E +  V ++ + ++P ++++     + H P+++ + A     Q Y GGV     CG   L+HGV  VGYG+   S        Y I+KNSWG +WG+ G+ R+ R      G+CG+N M
Sbjct:  224 YPYLMEEGICQEQKEDVERVTISGYEDVPENDDESLVKALAHQPVSVAIEASGRDFQFYKGGVFNGK-CGTD-LDHGVAAVGYGSSKGS-------DYVIVKNSWGPRWGEKGFIRMKRNTGKPEGLCGINKM 347          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATK_PIG (Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.475e-12
Identity = 41/128 (32.03%), Postives = 64/128 (50.00%), Query Frame = 1
Query:   58 SYPYIGKRGKCQFDSEKIAVRVANFTNIPV-DENQIAAHLVHHGPLAIGLNAIF--MQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR-GMCGM 429
            +YPY+G+   C ++    A +   +  IP  +E  +   +   GP+++ ++A     Q Y  GV     C    LNH VL VGYG +         + +WIIKNSWG+ WG+ GY  + R +   CG+
Sbjct:  201 AYPYVGQDENCMYNPTGKAAKCRGYREIPEGNEKALKRAVARVGPVSVAIDASLTSFQFYSKGVYYDENCNSDNLNHAVLAVGYGIQK-------GKKHWIIKNSWGENWGNKGYILMARNKNNACGI 321          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: RD21A_ARATH (Cysteine proteinase RD21a OS=Arabidopsis thaliana GN=RD21A PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 44/130 (33.85%), Postives = 64/130 (49.23%), Query Frame = 1
Query:   61 YPYIGKRGKC-QFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCR----GRGMCGM 429
            YPY G  G C Q       V + ++ ++P    +     V H P++I + A     Q Y  G+     CG + L+HGV+ VGYG +         + YWI++NSWGK WG+ GY R+ R      G CG+
Sbjct:  224 YPYKGVDGTCDQIRKNAKVVTIDSYEDVPTYSEESLKKAVAHQPISIAIEAGGRAFQLYDSGIFDGS-CGTQ-LDHGVVAVGYGTEN-------GKDYWIVRNSWGKSWGESGYLRMARNIASSSGKCGI 344          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: ORYB_ORYSJ (Oryzain beta chain OS=Oryza sativa subsp. japonica GN=Os04g0670200 PE=1 SV=2)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 45/133 (33.83%), Postives = 65/133 (48.87%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKI-AVRVANFTNIPVDENQIAAHLVHHGPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRG----RGMCGMNTM 438
            YPY    GKC  + E    V +  F ++P ++ +     V H P+++ + A     Q Y  GV     CG   L+HGV+ VGYG           + YWI++NSWG +WG+ GY R+ R      G CG+  M
Sbjct:  229 YPYKAVDGKCDINRENAKVVSIDGFEDVPQNDEKSLQKAVAHQPVSVAIEAGGREFQLYHSGVFSGR-CGTS-LDHGVVAVGYGTDN-------GKDYWIVRNSWGPKWGESGYVRMERNINVTTGKCGIAMM 352          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CRUST_PANBO (Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 40/123 (32.52%), Postives = 59/123 (47.97%), Query Frame = 1
Query:   55 SSYPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHH-GPLAIGLNA--IFMQTYIGGVSCPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGR 414
            SSYPY      C++D+  I   V+++      +     H V + GP+++ ++A      +Y GGV     C   + NH V  VGYG             YWI+KNSWG  WG+ GY ++ R R
Sbjct:  192 SSYPYKAIDDNCRYDAGNIGATVSSYVEPASGDESALQHAVQNEGPVSVCIDAGQSSFGSYGGGVYYEPNCDSWYANHAVTAVGYGTDA------NGGDYWIVKNSWGAWWGESGYIKMARNR 308          
BLAST of DC900408 vs. ExPASy Swiss-Prot
Match: CATV_GVXN (Viral cathepsin OS=Xestia c-nigrum granulosis virus GN=VCATH PE=3 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.516e-12
Identity = 40/125 (32.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query:   61 YPYIGKRGKCQFDSEKIAVRVANFTNIPVDENQIAAHLVHHGPLAIGLNAIFMQTYIGGVS--CPLICGKKWLNHGVLLVGYGAKGFSILRLGNQPYWIIKNSWGKQWGDHGYYRLCRGRGMCGM 429
            YPY G  G C+  +  + +      ++   E ++   L   GP+++ ++ + +  Y  GV+  C +  G   LNHGVLLVGYG +        +  YW +KNSWG  WG+ G++R+ R    CG+
Sbjct:  219 YPYTGVDGVCKNTTRYVQLSGCYAYDLR-SEKKLRQVLHEKGPVSVAIDVVDLTNYKSGVAKHCSVDHG---LNHGVLLVGYGQEN-------DVKYWTLKNSWGSDWGEQGFFRIKRDVNSCGI 332          
The following BLAST results are available for this feature:
BLAST of DC900408 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 119
Match NameE-valueIdentityDescription
CATS_RAT5.070e-1333.08Cathepsin S OS=Rattus norvegicus GN=Ctss PE=2 SV=1[more]
CYSEP_VIGMU6.622e-1334.31Vignain OS=Vigna mungo PE=1 SV=1[more]
CATK_RABIT8.648e-1332.81Cathepsin K OS=Oryctolagus cuniculus GN=CTSK PE=1 ... [more]
ACTN_ACTCH1.129e-1234.81Actinidain OS=Actinidia chinensis PE=1 SV=4[more]
XCP1_ARATH1.475e-1233.83Xylem cysteine proteinase 1 OS=Arabidopsis thalian... [more]
CATK_PIG1.475e-1232.03Cathepsin K OS=Sus scrofa GN=CTSK PE=2 SV=1[more]
RD21A_ARATH2.516e-1233.85Cysteine proteinase RD21a OS=Arabidopsis thaliana ... [more]
ORYB_ORYSJ2.516e-1233.83Oryzain beta chain OS=Oryza sativa subsp. japonica... [more]
CRUST_PANBO2.516e-1232.52Crustapain OS=Pandalus borealis GN=Cys PE=1 SV=1[more]
CATV_GVXN2.516e-1232.00Viral cathepsin OS=Xestia c-nigrum granulosis viru... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900408 VSS Citrus sinensis cDNA clone VS28985 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900408 ID=DC900408|Name=DC900408|organism=Citrus sinensis|type=EST|length=684bp
TGAGGCCTCATGACAATGCATCCAATATTGATCGCGACTGAGGGCTAAAN
AGANAGTTCATATCCTTATATTGGGAAGCGTGGCAAATGCCAATTCGATT
CAGAGAAAATAGCCGTTCGAGTTGCAAATTTTACCAATATTCCTGTCGAT
GAGAACCAAATTGCTGCACATTTAGTCCACCACGGTCCTCTGGCTATTGG
GTTGAACGCTATATTCATGCAAACATACATTGGGGGAGTCTCATGCCCGC
TAATCTGCGGCAAGAAATGGCTCAACCACGGCGTTCTGCTCGTCGGGTAT
GGTGCCAAGGGCTTCTCAATTCTTAGGCTTGGAAACCAGCCGTATTGGAT
CATCAAGAATTCGTGGGGCAAGCAATGGGGAGACCATGGGTACTACCGGC
TCTGCCGAGGGCGTGGCATGTGTGGAATGAACACCATGGTTTCTGCAGTG
GTCACTCAAGTCTCCTCCTAAACTTGAAGTCCCTCTTATTAAGTTGGAAT
ATCTACAGAAAGCAATATAGACAGCTCATGTTATATGGTAGCTAGTTTCC
CTTTTGTTCTTGTTTGTGATCTTCTAATTATTGAAGCTTTTCCGGTTTCA
TAATTCCCCTTTCTCAAGTAAGTTCTGGATTAGACTTGAAAATGCTTTTC
AGACCTGCTCTTCTACATACTATTGTGTCTTCCA
back to top