DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLACH (Cell division control protein 2 homolog OS=Plasmodium chabaudi GN=CRK2 PE=3 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 9.352e-39
Identity = 81/198 (40.91%), Postives = 126/198 (63.64%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +        REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   +        K ++ QLL+G+ +CH + VLHRD+K  NLLI+ +G LKIADFGLA  F  P  ++  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G+P+ PG ++ +QL +I+K+ G+P+ +
Sbjct:   30 ALKKIRLEKEDEGIPSTAIREISILKELRHSNIVKLYDVIHAKKR--LILVFEHLDQDLKKLIDVCDGGLESVTAKSFLLQLLNGIAYCHEHRVLHRDLKPQNLLINREGELKIADFGLARAFGIPARRY--THEVVTLWYRAPDILMGSKKYSTPIDIWSVGCIFAEMVNGRPLFPGVSDTDQLMRIFKILGTPNSQ 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_HUMAN (Cell division control protein 2 homolog OS=Homo sapiens GN=CDC2 PE=1 SV=2)

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-38
Identity = 83/202 (41.09%), Postives = 122/202 (60.40%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS--PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        REI +L+ L HPN++ L+ ++       LYL+F ++  DL   + S  P        VK Y++Q+L G+  CH+  VLHRD+K  NLLIDD G +K+ADFGLA  F    +   T   +TLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQ--DSRLYLIFEFLSMDLKKYLDSIPPGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIR-VYTHEAITLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLAYO (Cell division control protein 2 homolog OS=Plasmodium yoelii yoelii GN=CRK2 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-38
Identity = 84/201 (41.79%), Postives = 129/201 (64.18%), Query Frame = 2
Query:   11 ALKKVRFDNLE---PESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +   P +V    REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   +        K ++ QLL+G+ +CH + VLHRD+K  NLLI+ +G LKIADFGLA  F  P  ++  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G+P+ PG +E +QL +I+K+ G+P+ +
Sbjct:   30 ALKKIRLEKEDEGIPSTVSI--REISILKELRHSNIVKLYDVIHAKKR--LILVFEHLDQDLKKLIDVCDGGLESVTAKSFLLQLLNGIAYCHEHRVLHRDLKPQNLLINREGELKIADFGLARAFGIPARRY--THEVVTLWYRAPDILMGSKKYSTPIDIWSVGCIFAEMVNGRPLFPGVSETDQLMRIFKILGTPNSQ 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLAFK (Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CRK2 PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-38
Identity = 83/198 (41.92%), Postives = 125/198 (63.13%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +        REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   E        K ++ QLL+G+ +CH+  VLHRD+K  NLLI+ +G LKIADFGLA  F  P  K+  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G P+ PG +E +QL +I+++ G+P+ +
Sbjct:   30 ALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKR--LVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKY--THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSK 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLAF7 (Cell division control protein 2 homolog OS=Plasmodium falciparum (isolate 3D7) GN=CRK2 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-38
Identity = 83/198 (41.92%), Postives = 125/198 (63.13%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +        REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   E        K ++ QLL+G+ +CH+  VLHRD+K  NLLI+ +G LKIADFGLA  F  P  K+  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G P+ PG +E +QL +I+++ G+P+ +
Sbjct:   30 ALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTKKR--LVLVFEHLDQDLKKLLDVCEGGLESVTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKY--THEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVNGTPLFPGVSEADQLMRIFRILGTPNSK 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2A_XENLA (Cell division control protein 2-A OS=Xenopus laevis GN=cdc2-A PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 1.221e-38
Identity = 86/202 (42.57%), Postives = 124/202 (61.39%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R +N E        REI +L+ L HPN++ L  L        LYL+F ++  DL   + S P  ++ +   VK Y++Q+L G+  CH+  VLHRD+K  NLLID  GV+K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AE+   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QVVAMKKIRLENEEEGVPSTAIREISLLKELQHPNIVCL--LDVLMQDSRLYLIFEFLSMDLKKYLDSIPSGQYIDTMLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDSKGVIKLADFGLARAFGIPVR-VYTHEVVTLWYRAPEVLLGSVRYSTPVDVWSIGTIFAEIATKKPLFHGDSEIDQLFRIFRALGTPNNE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: KP58_DROME (Serine/threonine-protein kinase PITSLRE OS=Drosophila melanogaster GN=Pitslre PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.595e-38
Identity = 83/204 (40.69%), Postives = 127/204 (62.25%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVK---FTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+++ +  +        REI  L +  HPN++ +  +V       +++V  Y+EHDL  L+ + + +   F   +VKC   QLL  + H H+N +LHRD+K SNLL+   G+LK+ DFGLA  +  P  K+  TS VVTLWYR PELLL +  Y   +D+WS GCI AE L   P+ PG++E+++L++I+K  G+P+E+
Sbjct:  582 EIVALKRLKMEKEKEGFPITSLREINTLLKGQHPNIVTVREIVVGSNMDKIFIVMDYVEHDLKSLMETMKNRKQSFFPGEVKCLTQQLLRAVAHLHDNWILHRDLKTSNLLLSHKGILKVGDFGLAREYGSPIKKY--TSLVVTLWYRAPELLLCSPVYSTPIDVWSVGCIFAEFLQMLPLFPGKSEIDELNRIFKELGTPNEK 783          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKD1_ARATH (Cyclin-dependent kinase D-1 OS=Arabidopsis thaliana GN=CDKD-1 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.595e-38
Identity = 87/200 (43.50%), Postives = 122/200 (61.00%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFF-DPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VA+KK+R    E E V   A REI +L+ L HP++I+L      + +  L++VF +ME DL  ++    +  +   VK Y+  +L GLE+CH   VLHRD+K +NLLI  +G LK+ADFGLA  F  P  K   T +V   WYR PELL GA  Y   VD+W+AGCI AELL  +P + G ++++QL KI+   G+P  +
Sbjct:   37 VAIKKIRLGK-EKEGVNVTALREIKLLKELKHPHIIELIDAFPHKEN--LHIVFEFMETDLEAVIRDRNLYLSPGDVKSYLQMILKGLEYCHGKWVLHRDMKPNNLLIGPNGQLKLADFGLARIFGSPGRK--FTHQVFARWYRAPELLFGAKQYDGAVDVWAAGCIFAELLLRRPFLQGNSDIDQLSKIFAAFGTPKAD 231          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK17_RAT (Cell division protein kinase 17 OS=Rattus norvegicus GN=Cdk17 PE=1 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 1.595e-38
Identity = 82/199 (41.21%), Postives = 127/199 (63.82%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  +V +  S  L LVF Y++ DL   +       +   VK +++Q+L GL +CH   VLHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+++Y   +D+W  GCI  E+ +G+P+ PG T  ++LH I++L G+PS+E
Sbjct:  217 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDIVHTDKS--LTLVFEYLDKDLKQYMDDCGSIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQE 411          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK17_HUMAN (Cell division protein kinase 17 OS=Homo sapiens GN=CDK17 PE=1 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 1.595e-38
Identity = 82/199 (41.21%), Postives = 127/199 (63.82%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  +V +  S  L LVF Y++ DL   +       +   VK +++Q+L GL +CH   VLHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+++Y   +D+W  GCI  E+ +G+P+ PG T  ++LH I++L G+PS+E
Sbjct:  217 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDIVHTDKS--LTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQE 411          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC2H_PLACH9.352e-3940.91Cell division control protein 2 homolog OS=Plasmod... [more]
CDC2_HUMAN1.221e-3841.09Cell division control protein 2 homolog OS=Homo sa... [more]
CDC2H_PLAYO1.221e-3841.79Cell division control protein 2 homolog OS=Plasmod... [more]
CDC2H_PLAFK1.221e-3841.92Cell division control protein 2 homolog OS=Plasmod... [more]
CDC2H_PLAF71.221e-3841.92Cell division control protein 2 homolog OS=Plasmod... [more]
CDC2A_XENLA1.221e-3842.57Cell division control protein 2-A OS=Xenopus laevi... [more]
KP58_DROME1.595e-3840.69Serine/threonine-protein kinase PITSLRE OS=Drosoph... [more]
CDKD1_ARATH1.595e-3843.50Cyclin-dependent kinase D-1 OS=Arabidopsis thalian... [more]
CDK17_RAT1.595e-3841.21Cell division protein kinase 17 OS=Rattus norvegic... [more]
CDK17_HUMAN1.595e-3841.21Cell division protein kinase 17 OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398; Name=DC900398; organism=Citrus sinensis; type=EST; length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top