DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK10_DICDI (Probable cyclin-dependent kinase 10 OS=Dictyostelium discoideum GN=cdk10 PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.809e-43
Identity = 88/201 (43.78%), Postives = 129/201 (64.18%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKKV+    + + +   + REI IL+ + HPN++ L  +V       +YLVF Y+EHD+A L+ +    F   ++KC++ QLL  +E+ H++ ++HRD+K SNLL  ++G LK+ADFGLA  F       +T  +VTLWYR PELLLG   Y   VDLWS G I  ELL G+P++ G  EV+Q+ +I+ L G P+E+
Sbjct:   31 RIVALKKVKIGQQDKDGIPLTSLREIQILKEIKHPNIVSLLEVVIGSTGDKIYLVFEYLEHDVASLIDNINKPFKLSEIKCFLLQLLRAVEYLHSHWIIHRDLKCSNLLYGNNGNLKLADFGLARKFG-YPIESITPCMVTLWYRSPELLLGCQKYSTAVDLWSIGSIFGELLIGRPLITGNNEVDQIMRIFNLLGEPNEQ 230          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CD11A_HUMAN (Cell division protein kinase 11A OS=Homo sapiens GN=CDK11A PE=1 SV=3)

HSP 1 Score: 174.481 bits (441), Expect = 3.669e-43
Identity = 86/200 (43.00%), Postives = 127/200 (63.50%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+++ +  +        REI  + +  HPN++ +  +V       +Y+V +Y+EHDL  L+ + +  F   +VK  M QLL G++H H+N +LHRD+K SNLL+   G+LK+ DFGLA  +    K   T  VVT WYR PELLLGA +Y   VD+WS GCI  ELL  KP+ PG +E++Q++K++K  G+PSE+
Sbjct:  447 EIVALKRLKMEKEKEGFPITSLREINTILKAQHPNIVTVREIVVGSNMDKIYIVMNYVEHDLKSLMETMKQPFLPGEVKTLMIQLLRGVKHLHDNWILHRDLKTSNLLLSHAGILKVGDFGLAREYGSPLK-AYTPVVVTQWYRAPELLLGAKEYSTAVDMWSVGCIFGELLTQKPLFPGNSEIDQINKVFKELGTPSEK 645          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK7_MOUSE (Cell division protein kinase 7 OS=Mus musculus GN=Cdk7 PE=1 SV=2)

HSP 1 Score: 172.555 bits (436), Expect = 1.394e-42
Identity = 93/204 (45.59%), Postives = 132/204 (64.71%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESV---KFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK++  +         +   REI +L+ L HPN+I L      + + SL  VF +ME DL  ++    +  T   +K YM   L GLE+ H + +LHRD+K +NLL+D++GVLK+ADFGLA SF  PN  +  T +VVT WYR PELL GA  YGVGVD+W+ GCILAELL   P +PG ++++QL +I++  G+P+EE
Sbjct:   36 QIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISL--VFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAY--THQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 235          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK7_HUMAN (Cell division protein kinase 7 OS=Homo sapiens GN=CDK7 PE=1 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 1.394e-42
Identity = 93/204 (45.59%), Postives = 132/204 (64.71%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESV---KFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK++  +         +   REI +L+ L HPN+I L      + + SL  VF +ME DL  ++    +  T   +K YM   L GLE+ H + +LHRD+K +NLL+D++GVLK+ADFGLA SF  PN  +  T +VVT WYR PELL GA  YGVGVD+W+ GCILAELL   P +PG ++++QL +I++  G+P+EE
Sbjct:   36 QIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISL--VFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAY--THQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 235          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK7_RAT (Cell division protein kinase 7 (Fragment) OS=Rattus norvegicus GN=Cdk7 PE=2 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 2.378e-42
Identity = 93/204 (45.59%), Postives = 132/204 (64.71%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESV---KFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK++  +         +   REI +L+ L HPN+I L      + + SL  VF +ME DL  ++    +  T   +K YM   L GLE+ H + +LHRD+K +NLL+D++GVLK+ADFGLA SF  PN  +  T +VVT WYR PELL GA  YGVGVD+W+ GCILAELL   P +PG ++++QL +I++  G+P+EE
Sbjct:   28 QIVAIKKIKLGHRSEAKDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISL--VFDFMETDLEVIIKDNSLVLTPSHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNWAY--THQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 227          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2C_DROME (Cell division control protein 2 cognate OS=Drosophila melanogaster GN=cdc2c PE=1 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.378e-42
Identity = 89/198 (44.95%), Postives = 127/198 (64.14%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            VALKK+R +  E E V   A REI +L+ L HPNV++L  +V S    +LY++F Y+  DL  L+   +  FT   +K YMHQ+L  +  CH N +LHRD+K  NLL+D  G +K+ADFGLA  F+   +   T  VVTLWYR PE+LLG   Y  GVD+WS GCI +E++  + + PG +E++QL++I++   +P E
Sbjct:   34 VALKKIRLEG-ETEGVPSTAIREISLLKNLKHPNVVQLFDVVIS--GNNLYMIFEYLNMDLKKLMDKKKDVFTPQLIKSYMHQILDAVGFCHTNRILHRDLKPQNLLVDTAGKIKLADFGLARAFNVPMR-AYTHEVVTLWYRAPEILLGTKFYSTGVDIWSLGCIFSEMIMRRSLFPGDSEIDQLYRIFRTLSTPDE 227          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK9_CAEEL (Probable cell division protein kinase 9 OS=Caenorhabditis elegans GN=cdk-9 PE=2 SV=2)

HSP 1 Score: 171.014 bits (432), Expect = 4.057e-42
Identity = 95/214 (44.39%), Postives = 132/214 (61.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKL--------EGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHK----HPM-TSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VALKK+  +N E E     A RE+ +L +L HPN+  L         G   S+   + YLV     HDLAGL+++P+++ +   +K  M  L+SGL   H + +LHRD+K +N+LI  DG+LK+ADFGLA  F          P+ T+RVVTLWYRPPELLLG   YG  +D+W AGCI+AE+   +PIM G TE +QL  I  LCGS +++
Sbjct:  109 RMVALKKILMEN-EKEGFPITALREVKMLEQLKHPNITDLIEVCSAKSTGTTGSKDRATFYLVMALCAHDLAGLLSNPKIRMSLVHIKTMMKHLMSGLNKLHRSKILHRDMKAANVLISKDGILKLADFGLARPFVQRENGAGPRPLYTNRVVTLWYRPPELLLGDRQYGTKIDVWGAGCIMAEMWTRQPIMQGDTEQKQLQLISGLCGSINKD 321          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK7_XENLA (Cell division protein kinase 7 OS=Xenopus laevis GN=cdk7 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 4.057e-42
Identity = 93/204 (45.59%), Postives = 133/204 (65.20%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESV---KFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK++  +    +    +   REI +L+ L HPN+I L      + + SL  VF +ME DL  ++    +  T   +K YM   L GLE+ H+  +LHRD+K +NLL+D++GVLK+ADFGLA SF  PN  +  T +VVT WYR PELL GA  YGVGVD+W+ GCILAELL   P +PG ++++QL +I++  G+P+EE
Sbjct:   42 RIVAIKKIKLGHRAEANDGINRTALREIKLLQELSHPNIIGLLDAFGHKSNISL--VFDFMETDLEVIIKDTSLVLTPAHIKSYMLMTLQGLEYLHHLWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRIY--THQVVTRWYRSPELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEE 241          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK5_DICDI (Cell division protein kinase 5 homolog OS=Dictyostelium discoideum GN=cdk5 PE=2 SV=2)

HSP 1 Score: 170.629 bits (431), Expect = 5.298e-42
Identity = 88/201 (43.78%), Postives = 133/201 (66.17%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK++R D+ E E V   A REI +L+ L HPN+++L  ++ +     L LVF Y++ DL   +     + ++P +K +M+QLL G+  CH++ VLHRD+K  NLLI+  G LK+ADFGLA  F    +   +  VVTLWYR P++L+G+  Y   +D+WSAGCI AE+ +G+P+ PG    +QL +I+K+ G+P+EE
Sbjct:   28 EIVALKRIRLDS-EDEGVPCTAIREISLLKELKHPNIVRLHDVIHTERK--LTLVFEYLDQDLKKYLDECGGEISKPTIKSFMYQLLKGVAFCHDHRVLHRDLKPQNLLINRKGELKLADFGLARAFGIPVR-TYSHEVVTLWYRAPDVLMGSRKYSTPIDIWSAGCIFAEMASGRPLFPGSGTSDQLFRIFKILGTPNEE 224          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC28_CANAL (Cell division control protein 28 OS=Candida albicans GN=CDC28 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 9.037e-42
Identity = 91/203 (44.83%), Postives = 136/203 (67.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PE-VKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VALKK+R ++ E E V   A REI +L+ +   N+++L  ++ S  S  LYLVF +++ DL   + S P+ V      +K +M+QL+ G++HCH++ VLHRD+K  NLLID +G LK+ADFGLA  F    +   T  VVTLWYR PE+LLG   Y  GVD+WS GCI AE+   KP+ PG +E++++ +I+++ G+P+EE
Sbjct:   32 RVVALKKIRLES-EDEGVPSTAIREISLLKEMKDDNIVRLYDIIHSD-SHKLYLVFEFLDLDLKKYMESIPQGVGLGANMIKRFMNQLIRGIKHCHSHRVLHRDLKPQNLLIDKEGNLKLADFGLARAFGVPLR-AYTHEVVTLWYRAPEILLGGKQYSTGVDMWSVGCIFAEMCNRKPLFPGDSEIDEIFRIFRILGTPNEE 231          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDK10_DICDI2.809e-4343.78Probable cyclin-dependent kinase 10 OS=Dictyosteli... [more]
CD11A_HUMAN3.669e-4343.00Cell division protein kinase 11A OS=Homo sapiens G... [more]
CDK7_MOUSE1.394e-4245.59Cell division protein kinase 7 OS=Mus musculus GN=... [more]
CDK7_HUMAN1.394e-4245.59Cell division protein kinase 7 OS=Homo sapiens GN=... [more]
CDK7_RAT2.378e-4245.59Cell division protein kinase 7 (Fragment) OS=Rattu... [more]
CDC2C_DROME2.378e-4244.95Cell division control protein 2 cognate OS=Drosoph... [more]
CDK9_CAEEL4.057e-4244.39Probable cell division protein kinase 9 OS=Caenorh... [more]
CDK7_XENLA4.057e-4245.59Cell division protein kinase 7 OS=Xenopus laevis G... [more]
CDK5_DICDI5.298e-4243.78Cell division protein kinase 5 homolog OS=Dictyost... [more]
CDC28_CANAL9.037e-4244.83Cell division control protein 28 OS=Candida albica... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top