DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_CARAU (Cell division control protein 2 homolog OS=Carassius auratus GN=cdc2 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 9.992e-41
Identity = 91/202 (45.05%), Postives = 127/202 (62.87%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        REI +L+ L HPNV++L  L        LYLVF ++  DL   + S P  +F +P  VK Y++Q+L G+  CH   VLHRD+K  NLLID+ GV+K+ADFGLA  F    +   T  VVTLWYR PE+LLGA+ Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAVREISLLKELQHPNVVRL--LDVLMQESKLYLVFEFLSMDLKKYLDSIPSGQFMDPMLVKSYLYQILEGILFCHCRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVR-VYTHEVVTLWYRAPEVLLGASRYSTPVDVWSIGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNNE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: PPK23_SCHPO (Serine/threonine-protein kinase ppk23 OS=Schizosaccharomyces pombe GN=ppk23 PE=2 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.305e-40
Identity = 89/202 (44.06%), Postives = 127/202 (62.87%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKF---MAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALKK++FD   P  + F     REI  L  + H N+++LE +V  +    +YLV  +MEHDL  L+ +    F + +VK  M QLL+     H++  LHRD+K SNLL+++ G +K+ADFGLA       K  +T  VVTLWYR PELLLGA  YG  +D+WS GCI AE++   P+  G++E++QL+KI+ L G P+ E
Sbjct:   99 LVALKKIKFD---PNGIGFPITSLREIESLSSIRHDNIVELEKVVVGKDLKDVYLVMEFMEHDLKTLLDNMPEDFLQSEVKTLMLQLLAATAFMHHHWYLHRDLKPSNLLMNNTGEIKLADFGLARPVS-EPKSSLTRLVVTLWYRAPELLLGAPSYGKEIDMWSIGCIFAEMITRTPLFSGKSELDQLYKIFNLLGYPTRE 296          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_CANAL (Serine/threonine-protein kinase BUR1 OS=Candida albicans GN=CRK1 PE=3 SV=2)

HSP 1 Score: 166.007 bits (419), Expect = 1.305e-40
Identity = 85/196 (43.37%), Postives = 115/196 (58.67%), Query Frame = 2
Query:   68 REILILRRLDHPNVIKLEGLVTSR-----------MSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPN----------HKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSP 592
            REI IL++L+H N++ ++ ++              M  S Y V  YM  DL GL+ +P++K    Q+KC M QLL G+++ HN   LHRDIK +N+LI  DGVLKIADFGLA  +  N           +   T  VVT WYRPPE+LLG   Y   VDLW  GC+ AEL  GKPI+ G+++  Q   +++L GSP
Sbjct:   90 REITILKQLNHKNILTIQDMIFEEPKMSNRTDIITMRGSFYTVTPYMSSDLVGLLENPKIKLELGQIKCIMQQLLKGIQYVHNQKFLHRDIKAANILIGQDGVLKIADFGLARIYHGNVPRLGMGPGGGEKAYTGLVVTRWYRPPEILLGERKYTTAVDLWGIGCVFAELFTGKPILVGKSDSHQAQIVFELVGSP 285          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKA1_ARATH (Cyclin-dependent kinase A-1 OS=Arabidopsis thaliana GN=CDKA-1 PE=1 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.704e-40
Identity = 90/201 (44.78%), Postives = 132/201 (65.67%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N++KL+ +V S     LYLVF Y++ DL   + ++P+       +K Y++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE+++ KP+ PG +E++QL KI+++ G+P E+
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHSNIVKLQDVVHSEKR--LYLVFEYLDLDLKKHMDSTPDFSKDLHMIKTYLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSHHYSTPVDIWSVGCIFAEMISQKPLFPGDSEIDQLFKIFRIMGTPYED 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_VIGAC (Cell division control protein 2 homolog OS=Vigna aconitifolia GN=CDC2 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.704e-40
Identity = 91/201 (45.27%), Postives = 133/201 (66.17%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + +SPE      QVK +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  +P+ PG +E+++L KI+++ G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKR--LYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_MAIZE (Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.704e-40
Identity = 90/201 (44.78%), Postives = 131/201 (65.17%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ ++H N+++L  +V S     +YLVF Y++ DL   + S PE       +K Y++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLGA  Y   VD+WS GCI AE++  KP+ PG +E+++L KI+++ G+P+E+
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMNHGNIVRLHDVVHSEKR--IYLVFEYLDLDLKKFMDSCPEFAKNPTLIKSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGARQYSTPVDVWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRILGTPNEQ 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_THEPA (Cell division control protein 2 homolog OS=Theileria parva GN=CRK2 PE=3 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.704e-40
Identity = 84/199 (42.21%), Postives = 128/199 (64.32%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPS 595
            +I ALKK+R +  +        REI +L+ L HPN++ L  ++ S     L LVF Y++ DL  L+ + +        K +++Q+L G+ +CH++ +LHRD+K  NLLI+ +GVLK+ADFGLA +F  P   +  T  VVTLWYR P++L+G+  Y   VD+WS GCI AE++ G P+ PG +E +QL +I+K+ G+PS
Sbjct:   27 EICALKKIRVEEEDEGIPSTAIREISLLKELHHPNIVWLRDVIHSEKC--LTLVFEYLDQDLKKLLDACDGGLEPTTAKSFLYQILRGISYCHDHRILHRDLKPQNLLINREGVLKLADFGLARAFAIPVRSY--THEVVTLWYRAPDVLMGSKKYSTAVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKILGTPS 221          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK3_MOUSE (Cell division protein kinase 3 OS=Mus musculus GN=Cdk3 PE=1 SV=2)

HSP 1 Score: 165.236 bits (417), Expect = 2.226e-40
Identity = 94/201 (46.77%), Postives = 130/201 (64.68%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            ++VALKK+R D LE E V   A REI +L+ L HPN+IKL  +V       LY+VF ++  DL   + +SP  +   P VK Y+ QLL G+  CH++ V+HRD+K  NLL+D  G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+ S GCI AE++ GK + PG +E++QL +I++  G+PSE
Sbjct:   28 QLVALKKIRLD-LEAEGVPSTAVREISLLKELKHPNIIKLLDVVHREKK--LYMVFEFLTQDLKRHMDSSPTSELPLPVVKSYLAQLLEGVSFCHSHRVIHRDLKPQNLLLDGLGAIKLADFGLARAFGVPLR-TYTHEVVTLWYRAPEILLGSKFYSTAVDI-SIGCIFAEMVTGKALFPGDSEIDQLFRIFRTLGTPSE 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK11_DICDI (PITSVRE serine/threonine protein-kinase cdk11 OS=Dictyostelium discoideum GN=cdk11 PE=3 SV=1)

HSP 1 Score: 165.236 bits (417), Expect = 2.226e-40
Identity = 82/201 (40.80%), Postives = 134/201 (66.67%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKK++ +  E E +   + REI +L  L H N+++++ +V  +   S+++   +++HDL GL+   +  F   ++K  + QLL+G+ + H+N V+HRD+K +NLL  + GVLKIADFGLA  +    K P++  VVTLWYR PELLL    Y   +D+WS GCI AE+++ + ++ G +E++Q+ KI+KL G+P+E+
Sbjct:   76 EIVALKKIKMER-EREGIPITSVREIKVLMELKHDNIVQIKEIVLGKNINSIFMAMEFIDHDLRGLMEVIKKPFLPSEIKTLIQQLLNGVSYMHDNWVIHRDLKTANLLYTNKGVLKIADFGLAREYGSPLK-PLSKGVVTLWYRAPELLLDTEIYTPAIDIWSVGCIFAEIISKEVLLQGSSEIDQMDKIFKLFGTPTEK 274          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK18_MOUSE (Cell division protein kinase 18 OS=Mus musculus GN=Cdk18 PE=1 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.907e-40
Identity = 89/200 (44.50%), Postives = 127/200 (63.50%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLV-TSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  L+ T R   SL LVF Y++ DL   +           VK +M QLL GL +CH+  +LHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+T+Y   +D+W  GCIL E+  GKP+ PG T  E+LH I++L G+P+EE
Sbjct:  146 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDLIHTDR---SLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEE 340          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC2_CARAU9.992e-4145.05Cell division control protein 2 homolog OS=Carassi... [more]
PPK23_SCHPO1.305e-4044.06Serine/threonine-protein kinase ppk23 OS=Schizosac... [more]
BUR1_CANAL1.305e-4043.37Serine/threonine-protein kinase BUR1 OS=Candida al... [more]
CDKA1_ARATH1.704e-4044.78Cyclin-dependent kinase A-1 OS=Arabidopsis thalian... [more]
CDC2_VIGAC1.704e-4045.27Cell division control protein 2 homolog OS=Vigna a... [more]
CDC2_MAIZE1.704e-4044.78Cell division control protein 2 homolog OS=Zea may... [more]
CDC2H_THEPA1.704e-4042.21Cell division control protein 2 homolog OS=Theiler... [more]
CDK3_MOUSE2.226e-4046.77Cell division protein kinase 3 OS=Mus musculus GN=... [more]
CDK11_DICDI2.226e-4040.80PITSVRE serine/threonine protein-kinase cdk11 OS=D... [more]
CDK18_MOUSE2.907e-4044.50Cell division protein kinase 18 OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top