DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_VIGUN (Cell division control protein 2 homolog OS=Vigna unguiculata GN=CDC2 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.907e-40
Identity = 90/201 (44.78%), Postives = 133/201 (66.17%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAG-LVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + +SPE      QVK +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GC+ AE++  +P+ PG +E+++L KI+++ G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHRNIVRLQDVVHSEKR--LYLVFEYLDLDLKKHMDSSPEFVKDPRQVKMFLYQILCGIAYCHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCLFAEMVNRRPLFPGDSEIDELFKIFRILGTPNEE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_MOUSE (Cell division control protein 2 homolog OS=Mus musculus GN=Cdc2 PE=1 SV=3)

HSP 1 Score: 164.851 bits (416), Expect = 2.907e-40
Identity = 88/202 (43.56%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK+R ++ E        REI +L+ L HPN++ L+ ++       LYL+F ++  DL   + S P  +F +   VK Y+HQ+L G+  CH+  VLHRD+K  NLLIDD G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQ--DSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIR-VYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CC2H3_TRYBB (Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 2.907e-40
Identity = 86/200 (43.00%), Postives = 124/200 (62.00%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSE 598
            +IVALKKVR D  +    +   RE+ IL+ + HPN++ L  ++ +     LYL+F Y++HDL   +      FT   +K  ++QLL GL  CH + ++HRD+K +N+L+  D  +KIADFGLA  F  P H +  T  VVTLWYR PE+LLG   Y   VD+WS GCI AEL  GK +  G +E+ QL +I+++ G+P +
Sbjct:   47 QIVALKKVRLDRTDEGIPQTALREVSILQEIHHPNIVNLLDVICA--DGKLYLIFEYVDHDLKKALEKRGGAFTGTTLKKIIYQLLEGLSFCHRHRIVHRDLKPANILVTTDNSVKIADFGLARAFQIPMHTY--THEVVTLWYRAPEILLGEKHYTPAVDMWSIGCIFAELARGKVLFRGDSEIGQLFEIFQVLGTPMD 242          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CKD18_RAT (Cell division protein kinase 18 OS=Rattus norvegicus GN=Cdk18 PE=1 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.797e-40
Identity = 89/200 (44.50%), Postives = 126/200 (63.00%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLV-TSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  L+ T R   SL LVF Y++ DL   +           VK +M QLL GL +CH   +LHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+T+Y   +D+W  GCIL E+  GKP+ PG T  E+LH I++L G+P+EE
Sbjct:  146 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDLIHTDR---SLTLVFEYLDSDLKQYLDHCGNLMNMHNVKIFMFQLLRGLAYCHRRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCILYEMATGKPLFPGSTVKEELHLIFRLLGTPTEE 340          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_THEAN (Cell division control protein 2 homolog OS=Theileria annulata GN=CRK2 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.797e-40
Identity = 83/199 (41.71%), Postives = 128/199 (64.32%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLA-SFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPS 595
            +I ALKK+R +  +        REI +L+ L HPN++ L  ++ S     L LVF Y++ DL  L+ + +        K +++Q+L G+ +CH++ +LHRD+K  NLLI+ +GVLK+ADFGLA +F  P   +  T  VVTLWYR P++L+G+  Y   VD+WS GCI AE++ G P+ PG +E +QL +I+K+ G+P+
Sbjct:   27 EICALKKIRVEEEDEGIPSTAIREISLLKELHHPNIVWLRDVIHSEKC--LTLVFEYLDQDLKKLLDACDGGLEPTTAKSFLYQILRGISYCHDHRILHRDLKPQNLLINREGVLKLADFGLARAFAIPVRSY--THEVVTLWYRAPDVLMGSKKYSTAVDIWSVGCIFAEMINGVPLFPGISEQDQLKRIFKILGTPN 221          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK20_PONAB (Cell division protein kinase 20 OS=Pongo abelii GN=CDK20 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.477e-40
Identity = 87/201 (43.28%), Postives = 119/201 (59.20%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRL-DHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALKKV    LE        REI  L+ + D+  V++L+ +     S    L F +M  DLA +V   +    + QVK Y+  LL G+  CH N ++HRD+K +NLLI   G LKIADFGLA  F P+     T +V T WYR PELL GA  Y  GVDLW+ GCI+ ELL G P+ PG+ ++EQL  + ++ G+P+ +
Sbjct:   28 EIVALKKVALRRLEDGIPNQALREIKALQEMEDNQYVVQLKAVFPH--SAGFVLAFEFMLSDLAEVVRHAQRPLAQAQVKSYLQMLLKGVSFCHANNIVHRDLKPANLLISASGQLKIADFGLARVFSPDGSRLYTHQVATRWYRAPELLYGARQYDQGVDLWAVGCIMGELLNGSPLFPGKNDIEQLCYVLRILGTPNPQ 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDKA1_ORYSJ (Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 8.459e-40
Identity = 88/201 (43.78%), Postives = 130/201 (64.68%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L  ++ S     +YLVF Y++ DL   + S PE       +K Y++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  KP+ PG +E+++L KI+++ G+P+E+
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMHHGNIVRLHDVIHSEKR--IYLVFEYLDLDLKKFMDSCPEFAKNPTLIKSYLYQILRGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRQYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIFRVLGTPNEQ 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: BUR1_YEAST (Serine/threonine-protein kinase BUR1 OS=Saccharomyces cerevisiae GN=SGV1 PE=1 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.105e-39
Identity = 93/221 (42.08%), Postives = 132/221 (59.73%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLV-----------TSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFF---DPNHKHP--------MTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            VA+KK+   ++E +     A REI IL+RL+H N+IKL  +V           +S +  S Y++  YM  DL+G++ +P +      +K  M Q+L GL + H    +HRDIK +N+LID +GVLK+ADFGLA  +    PN K+P         TS VVT WYR PEL+LG   Y   VD+W  GC+ AE    KPI+ G+T+++Q H I+KL G+P+EE
Sbjct:   86 VAMKKI-IVSVEKDLFPITAQREITILKRLNHKNIIKLIEMVYDHSPDITNAASSNLHKSFYMILPYMVADLSGVLHNPRINLEMCDIKNMMLQILEGLNYIHCAKFMHRDIKTANILIDHNGVLKLADFGLARLYYGCPPNLKYPGGAGSGAKYTSVVVTRWYRAPELVLGDKQYTTAVDIWGVGCVFAEFFEKKPILQGKTDIDQGHVIFKLLGTPTEE 305          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK5_XENLA (Cell division protein kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.443e-39
Identity = 90/201 (44.78%), Postives = 125/201 (62.19%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELL-AGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVALK+VR D+ +        REI +L+ L H N+++L  ++ S     L LVF + + DL     S         VK +M+QLL GL  CH+  VLHRD+K  NLLI+ +G LK+ADFGLA  F    +   ++ VVTLWYRPP++L GA  Y   +D+WSAGCI AEL  AG+P+ PG    +QL +I++L G+P+EE
Sbjct:   28 EIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKK--LTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFMYQLLKGLAFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVR-CYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEE 225          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK16_MOUSE (Cell division protein kinase 16 OS=Mus musculus GN=Cdk16 PE=1 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.443e-39
Identity = 85/199 (42.71%), Postives = 124/199 (62.31%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  ++ +  S  L LVF Y++ DL   +           VK ++ QLL GL +CH   VLHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+TDY   +D+W  GCI  E+  G+P+ PG T  EQLH I+++ G+P+EE
Sbjct:  190 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDIIHTEKS--LTLVFEYLDKDLKQYLDDCGNVINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTK-TYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEE 384          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC2_VIGUN2.907e-4044.78Cell division control protein 2 homolog OS=Vigna u... [more]
CDC2_MOUSE2.907e-4043.56Cell division control protein 2 homolog OS=Mus mus... [more]
CC2H3_TRYBB2.907e-4043.00Cell division control protein 2 homolog 3 OS=Trypa... [more]
CKD18_RAT3.797e-4044.50Cell division protein kinase 18 OS=Rattus norvegic... [more]
CDC2H_THEAN3.797e-4041.71Cell division control protein 2 homolog OS=Theiler... [more]
CDK20_PONAB6.477e-4043.28Cell division protein kinase 20 OS=Pongo abelii GN... [more]
CDKA1_ORYSJ8.459e-4043.78Cyclin-dependent kinase A-1 OS=Oryza sativa subsp.... [more]
BUR1_YEAST1.105e-3942.08Serine/threonine-protein kinase BUR1 OS=Saccharomy... [more]
CDK5_XENLA1.443e-3944.78Cell division protein kinase 5 OS=Xenopus laevis G... [more]
CDK16_MOUSE1.443e-3942.71Cell division protein kinase 16 OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top