DC900398

Overview
NameDC900398
Unique NameDC900398
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length602
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig4027 contig Csv1_Contig4027:505..1106. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_RAT (Cell division control protein 2 homolog OS=Rattus norvegicus GN=Cdc2 PE=2 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.443e-39
Identity = 87/202 (43.07%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +IVA+KK+R ++ E        REI +L+ L HPN++ L+ ++       LYL+F ++  DL   + S P  +F +   VK Y++Q+L G+  CH+  VLHRD+K  NLLIDD G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QIVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQ--DSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIR-VYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2H_PLAVI (Cell division control protein 2 homolog OS=Plasmodium vivax GN=CRK2 PE=3 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 1.443e-39
Identity = 84/198 (42.42%), Postives = 126/198 (63.64%), Query Frame = 2
Query:   11 ALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFD-PNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ALKK+R +  +        REI IL+ L H N++KL  ++ ++    L LVF +++ DL  L+   +        K ++ QLLSG+ +CH + VLHRD+K  NLLI+ +G LKIADFGLA  F  P  K+  T  VVTLWYR P++L+G+  Y   +D+WS GCI AE++ G+P+ PG +E +QL +I+++ G+P+ E
Sbjct:   30 ALKKIRLEKEDEGIPSTAIREISILKELKHSNIVKLYDVIHTKKR--LILVFEHLDQDLKKLLDVCDGGLESVTAKSFLLQLLSGIAYCHEHRVLHRDLKPQNLLINREGELKIADFGLARAFGIPVRKY--THEVVTLWYRAPDILMGSKKYSTPIDMWSVGCIFAEMVNGRPLFPGVSETDQLMRIFRILGTPNSE 223          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2A_ANTMA (Cell division control protein 2 homolog A OS=Antirrhinum majus GN=CDC2A PE=2 SV=2)

HSP 1 Score: 162.54 bits (410), Expect = 1.443e-39
Identity = 90/201 (44.78%), Postives = 131/201 (65.17%), Query Frame = 2
Query:    8 VALKKVRFDNLEPESVKFMA-REILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDD-DGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +ALKK+R +  E E V   A REI +L+ + H N+++L+ +V S     LYLVF Y++ DL   + S PE       VK +++Q+L G+ +CH++ VLHRD+K  NLLID     LK+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS GCI AE++  +P+ PG +E+++L KI+++ G+P+EE
Sbjct:   30 IALKKIRLEQ-EDEGVPSTAIREISLLKEMQHGNIVRLQDVVHSEKR--LYLVFEYLDLDLKKHMDSCPEFSQDPRLVKMFLYQILRGIAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVR-TFTHEVVTLWYRAPEILLGSRHYSTPVDVWSVGCIFAEMVNQRPLFPGDSEIDELFKIFRVMGTPNEE 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK18_PONAB (Cell division protein kinase 18 OS=Pongo abelii GN=CDK18 PE=2 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 87/200 (43.50%), Postives = 127/200 (63.50%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLV-TSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  L+ T R   SL LVF Y++ DL   +       +   VK +M QLL GL +CH+  +LHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+T+Y   +D+W  GCI  E+  G+P+ PG T  E+LH I++L G+P+EE
Sbjct:  167 LVALKEIRLEHEEGAPCTAI-REVSLLKNLKHANIVTLHDLIHTDR---SLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEE 361          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK18_HUMAN (Cell division protein kinase 18 OS=Homo sapiens GN=CDK18 PE=1 SV=3)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 87/200 (43.50%), Postives = 127/200 (63.50%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLV-TSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  L+ T R   SL LVF Y++ DL   +       +   VK +M QLL GL +CH+  +LHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+T+Y   +D+W  GCI  E+  G+P+ PG T  E+LH I++L G+P+EE
Sbjct:  167 LVALKEIRLEHEEGAPCTAI-REVSLLKNLKHANIVTLHDLIHTDR---SLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTK-TYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEE 361          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDK16_HUMAN (Cell division protein kinase 16 OS=Homo sapiens GN=CDK16 PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 85/199 (42.71%), Postives = 124/199 (62.31%), Query Frame = 2
Query:    5 IVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVASPEVKFTEPQVKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            +VALK++R ++ E      + RE+ +L+ L H N++ L  ++ +  S  L LVF Y++ DL   +           VK ++ QLL GL +CH   VLHRD+K  NLLI++ G LK+ADFGLA       K   ++ VVTLWYRPP++LLG+TDY   +D+W  GCI  E+  G+P+ PG T  EQLH I+++ G+P+EE
Sbjct:  190 LVALKEIRLEHEEGAPCTAI-REVSLLKDLKHANIVTLHDIIHTEKS--LTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGLARAKSIPTK-TYSNEVVTLWYRPPDILLGSTDYSTQIDMWGVGCIFYEMATGRPLFPGSTVEEQLHFIFRILGTPTEE 384          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_ORYLU (Cell division control protein 2 homolog OS=Oryzias luzonensis GN=cdc2 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 86/202 (42.57%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        RE+ +L+ L HPNV++L  L        LYL+F ++  DL   + S P  ++ +P  VK Y++Q+L G+  CH   VLHRD+K  NLLID+ GV+K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ +
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAVREVSLLQELKHPNVVRL--LDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVR-VYTHEVVTLWYRAPEVLLGSPRYSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNND 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_ORYLA (Cell division control protein 2 homolog OS=Oryzias latipes GN=cdc2 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 86/202 (42.57%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        RE+ +L+ L HPNV++L  L        LYL+F ++  DL   + S P  ++ +P  VK Y++Q+L G+  CH   VLHRD+K  NLLID+ GV+K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ +
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAVREVSLLQELKHPNVVRL--LDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVR-VYTHEVVTLWYRAPEVLLGSPRYSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNND 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_ORYJA (Cell division control protein 2 homolog OS=Oryzias javanicus GN=cdc2 PE=2 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 86/202 (42.57%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        RE+ +L+ L HPNV++L  L        LYL+F ++  DL   + S P  ++ +P  VK Y++Q+L G+  CH   VLHRD+K  NLLID+ GV+K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ +
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAVREVSLLQELKHPNVVRL--LDVLMQESRLYLIFEFLSMDLKKYLDSIPSGQYMDPMLVKSYLYQILEGIYFCHRRRVLHRDLKPQNLLIDNKGVIKLADFGLARAFGVPVR-VYTHEVVTLWYRAPEVLLGSPRYSTPVDVWSTGTIFAELATKKPLFHGDSEIDQLFRIFRTLGTPNND 226          
BLAST of DC900398 vs. ExPASy Swiss-Prot
Match: CDC2_BOVIN (Cell division control protein 2 homolog OS=Bos taurus GN=CDC2 PE=2 SV=2)

HSP 1 Score: 162.155 bits (409), Expect = 1.884e-39
Identity = 86/202 (42.57%), Postives = 126/202 (62.38%), Query Frame = 2
Query:    2 KIVALKKVRFDNLEPESVKFMAREILILRRLDHPNVIKLEGLVTSRMSCSLYLVFHYMEHDLAGLVAS-PEVKFTEPQ-VKCYMHQLLSGLEHCHNNGVLHRDIKGSNLLIDDDGVLKIADFGLASFFDPNHKHPMTSRVVTLWYRPPELLLGATDYGVGVDLWSAGCILAELLAGKPIMPGRTEVEQLHKIYKLCGSPSEE 601
            ++VA+KK+R ++ E        REI +L+ L HPN++ L+ ++       LYL+F ++  DL   + S P  +F +   VK Y++Q+L G+  CH+  VLHRD+K  NLLIDD G +K+ADFGLA  F    +   T  VVTLWYR PE+LLG+  Y   VD+WS G I AEL   KP+  G +E++QL +I++  G+P+ E
Sbjct:   28 QVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQ--DSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIR-VYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNE 226          
The following BLAST results are available for this feature:
BLAST of DC900398 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
CDC2_RAT1.443e-3943.07Cell division control protein 2 homolog OS=Rattus ... [more]
CDC2H_PLAVI1.443e-3942.42Cell division control protein 2 homolog OS=Plasmod... [more]
CDC2A_ANTMA1.443e-3944.78Cell division control protein 2 homolog A OS=Antir... [more]
CDK18_PONAB1.884e-3943.50Cell division protein kinase 18 OS=Pongo abelii GN... [more]
CDK18_HUMAN1.884e-3943.50Cell division protein kinase 18 OS=Homo sapiens GN... [more]
CDK16_HUMAN1.884e-3942.71Cell division protein kinase 16 OS=Homo sapiens GN... [more]
CDC2_ORYLU1.884e-3942.57Cell division control protein 2 homolog OS=Oryzias... [more]
CDC2_ORYLA1.884e-3942.57Cell division control protein 2 homolog OS=Oryzias... [more]
CDC2_ORYJA1.884e-3942.57Cell division control protein 2 homolog OS=Oryzias... [more]
CDC2_BOVIN1.884e-3942.57Cell division control protein 2 homolog OS=Bos tau... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900398 VSS Citrus sinensis cDNA clone VS28972 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900398 ID=DC900398|Name=DC900398|organism=Citrus sinensis|type=EST|length=602bp
CAAAATCGTAGCACTAAAGAAAGTACGGTTTGACAATTTGGAACCTGAGA
GTGTGAAATTTATGGCTAGAGAGATTCTCATATTGCGGAGATTGGATCAT
CCAAATGTTATAAAGTTGGAAGGTTTAGTGACGTCAAGGATGTCATGTAG
TTTGTACCTGGTATTTCATTATATGGAGCATGATTTGGCTGGACTTGTTG
CAAGCCCTGAAGTGAAGTTCACAGAACCACAGGTTAAATGTTACATGCAT
CAACTGCTATCTGGACTTGAGCACTGTCACAACAATGGTGTGCTTCACCG
GGACATTAAAGGCTCTAATCTTCTAATTGATGATGATGGAGTGCTTAAAA
TAGCTGATTTTGGTTTGGCATCTTTCTTTGATCCAAATCATAAGCATCCT
ATGACTAGTCGAGTGGTTACTCTTTGGTATCGACCTCCTGAGCTGCTTCT
GGGGGCTACTGATTACGGTGTGGGTGTTGATCTATGGAGCGCAGGTTGTA
TTTTAGCTGAGCTACTGGCTGGGAAGCCCATTATGCCTGGTCGTACGGAG
GTAGAGCAACTACATAAGATATATAAGTTATGTGGTTCCCCTTCAGAAGA
AT
back to top