DC900396

Overview
NameDC900396
Unique NameDC900396
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length379
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7371_ARATH (UPF0737 protein AFP1 OS=Arabidopsis thaliana GN=AFP1 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 5.403e-25
Identity = 49/65 (75.38%), Postives = 56/65 (86.15%), Query Frame = 2
Query:    5 DMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVN 199
            +MPCV T GDGP+GKR++G LYRY  GEEVRI+CVCHG FLSPA+FVKHAGG  V HPL+HIVVN
Sbjct:  273 EMPCVFTKGDGPNGKRVDGILYRYGSGEEVRIMCVCHGDFLSPADFVKHAGGPHVDHPLRHIVVN 337          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7374_ARATH (UPF0737 protein AFP4 OS=Arabidopsis thaliana GN=AFP4 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.392e-19
Identity = 50/74 (67.57%), Postives = 55/74 (74.32%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKG-EEVRIVCVCHGSFLSPAEFVKHAG-------GGDV-AHPLKHIVV 196
            EDMPCVST   G DGKR+EGFLY Y    EEV+IVCVCHGSFLSPAEFV+H G       GGDV  +PL+HIVV
Sbjct:  239 EDMPCVSTRDVGADGKRVEGFLYWYGGNKEEVKIVCVCHGSFLSPAEFVRHGGGTVSDDDGGDVMINPLRHIVV 312          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7374_MAIZE (UPF0737 protein 4 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.398e-18
Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 214
            ++MP V T G   +G R+EGFLY+Y KGE VRIVC+CHGSFL+P+EFV+HAG G V +PL+HIVV+  P L
Sbjct:  192 QEMPGVFTKGLS-NGSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSATPNL 260          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7373_MAIZE (UPF0737 protein 3 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.398e-18
Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 214
            ++MP V T G   +G R+EGFLY+Y KGE VRIVC+CHGSFL+P+EFV+HAG G V +PL+HIVV+  P L
Sbjct:  194 QEMPGVFTKGLS-NGSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSATPNL 262          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7372_MAIZE (UPF0737 protein 2 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.398e-18
Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 214
            ++MP V T G   +G R+EGFLY+Y KGE VRIVC+CHGSFL+P+EFV+HAG G V +PL+HIVV+  P L
Sbjct:  194 QEMPGVFTKGLS-NGSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSATPNL 262          
BLAST of DC900396 vs. ExPASy Swiss-Prot
Match: U7371_MAIZE (UPF0737 protein 1 OS=Zea mays PE=2 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.398e-18
Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 2
Query:    2 EDMPCVSTTGDGPDGKRIEGFLYRYRKGEEVRIVCVCHGSFLSPAEFVKHAGGGDVAHPLKHIVVNPYPIL 214
            ++MP V T G   +G R+EGFLY+Y KGE VRIVC+CHGSFL+P+EFV+HAG G V +PL+HIVV+  P L
Sbjct:  325 QEMPGVFTKGLS-NGSRVEGFLYKYSKGE-VRIVCICHGSFLTPSEFVEHAGAGKVDNPLRHIVVSATPNL 393          
The following BLAST results are available for this feature:
BLAST of DC900396 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
U7371_ARATH5.403e-2575.38UPF0737 protein AFP1 OS=Arabidopsis thaliana GN=AF... [more]
U7374_ARATH3.392e-1967.57UPF0737 protein AFP4 OS=Arabidopsis thaliana GN=AF... [more]
U7374_MAIZE6.398e-1861.97UPF0737 protein 4 OS=Zea mays PE=2 SV=1[more]
U7373_MAIZE6.398e-1861.97UPF0737 protein 3 OS=Zea mays PE=2 SV=1[more]
U7372_MAIZE6.398e-1861.97UPF0737 protein 2 OS=Zea mays PE=2 SV=1[more]
U7371_MAIZE6.398e-1861.97UPF0737 protein 1 OS=Zea mays PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900396 VSS Citrus sinensis cDNA clone VS28970 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900396 ID=DC900396|Name=DC900396|organism=Citrus sinensis|type=EST|length=379bp
GGAAGATATGCCTTGTGTGTCTACAACAGGAGATGGCCCCGATGGAAAAA
GAATTGAAGGTTTTCTTTACAGATATAGGAAGGGTGAGGAAGTAAGGATC
GTATGTGTTTGTCATGGGAGCTTCCTCTCACCAGCCGAGTTTGTGAAGCA
TGCTGGTGGAGGCGATGTGGCGCACCCACTAAAGCACATTGTTGTTAACC
CTTATCCCATTTTGTAGAGCTGCCATTAAGGGTTCATGATGCTTTAAAAT
CTCTTTATTTTACATCTTTTGCGGGACGAGGCACTTGTATTGCGTTCAAT
ACATGAAGCCTCCTGTTGGGAAAAATAACAATTGTTACAGTGCACAAAAT
TGGTAAATCTACATAAGTAGTTTTCTCCG
back to top