DC900390

Overview
NameDC900390
Unique NameDC900390
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length603
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5641 contig Csv1_Contig5641:3..605. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_ARATH (Non-specific lipid-transfer protein 3 OS=Arabidopsis thaliana GN=LTP3 PE=2 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 7.211e-15
Identity = 40/92 (43.48%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            AAI+CG V   LAPC  YL+  G    +CC GV+ L     TT DRQ AC+CI+  A    G+    A  LP +CGV I  PI+   +C+ I
Sbjct:   23 AAISCGTVAGSLAPCATYLSKGGLVPPSCCAGVKTLNSMAKTTPDRQQACRCIQSTAKSISGLNPSLASGLPGKCGVSIPYPISMSTNCNNI 114          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP_PYRCO (Non-specific lipid-transfer protein OS=Pyrus communis PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.417e-15
Identity = 36/91 (39.56%), Postives = 52/91 (57.14%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            AITC QV + LAPC+ Y+   G    ACC G++ +     TT DRQAAC C+K+ A    G+    A  LP +CGV++   I+   +C+ +
Sbjct:   24 AITCSQVSANLAPCINYVRSGGAVPPACCNGIKTINGLAKTTPDRQAACNCLKNLAGSVSGVNPGNAESLPGKCGVNVPYKISTSTNCATV 114          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_PRUDU (Non-specific lipid-transfer protein 3 OS=Prunus dulcis PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.417e-15
Identity = 40/97 (41.24%), Postives = 53/97 (54.64%), Query Frame = 2
Query:  101 RGQAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAAT--RYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            +  AA++CGQV + L PC+ Y+   G  + +CCTGV  L     TTADRQ+ C C+K A     Y       A  LP +CGV+I   I+P  DC  I
Sbjct:   26 KAMAAVSCGQVVNNLTPCINYVANGGALNPSCCTGVRSLYSLAQTTADRQSICNCLKQAVNGIPYTNANAGLAAGLPGKCGVNIPYKISPSTDCKSI 122          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP3_BRANA (Non-specific lipid-transfer protein 3 OS=Brassica napus GN=LTP3 PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 9.417e-15
Identity = 39/92 (42.39%), Postives = 53/92 (57.61%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            AA++CG V   LA C+ YLT  G    ACC+GV  L +   TT DRQ AC+C+  AA     I + +A  LPK CGV+I   I+   +C+ +
Sbjct:   25 AALSCGTVSGNLAACIGYLTQNGPVPTACCSGVTSLNNMARTTPDRQQACRCLVGAANALPTINVARAAGLPKACGVNIPYKISKTTNCNSV 116          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTPC_ARATH (Non-specific lipid-transfer protein 12 OS=Arabidopsis thaliana GN=LTP12 PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 1.606e-14
Identity = 39/94 (41.49%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  107 QAAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKIS 388
            ++ I CG V S LA CL YLT  G     CC GV+ L     TT DR+  C+C+K A    +G+  D    LP  CGV I  PI+   +C  IS
Sbjct:   23 ESTIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSIS 116          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: SCA_LILLO (Stigma/stylar cysteine-rich adhesin OS=Lilium longiflorum GN=SCA PE=1 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.098e-14
Identity = 39/92 (42.39%), Postives = 48/92 (52.17%), Query Frame = 2
Query:  110 AAITCGQVDSFLAPCLAYLTGEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            +AITCGQVDS L  CL Y    G     CC GV  L +   TT DRQ AC C+K       G+       +P +CGV+I  PI    DC+K+
Sbjct:   21 SAITCGQVDSDLTSCLGYARKGGVIPPGCCAGVRTLNNLAKTTPDRQTACNCLKSLVNPSLGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKV 112          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP_DAUCA (Non-specific lipid-transfer protein OS=Daucus carota GN=EP2 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 4.674e-14
Identity = 38/95 (40.00%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  107 QAAITCGQVDSFLAPCLAYLTGEGKPS--RACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            +A +TCGQV   LAPCL YL  +        CC  V  L +   TT D++ AC C+K  A    G+ L+ A  LP  CGV+I   I+P  DC+++
Sbjct:   25 EAVLTCGQVTGALAPCLGYLRSQVNVPVPLTCCNVVRGLNNAARTTLDKRTACGCLKQTANAVTGLNLNAAAGLPARCGVNIPYKISPTTDCNRV 119          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP_AMACA (Non-specific lipid-transfer protein OS=Amaranthus caudatus PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.104e-14
Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGK--PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            A+TC  V   L PC+ YL G G   P   CC GV  LK    T ADR+ AC C+K AA + + +    A +L  +CGV +   ++P+++C+ +
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSV 93          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP8_ARATH (Non-specific lipid-transfer protein 8 OS=Arabidopsis thaliana GN=LTP8 PE=2 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.104e-14
Identity = 38/94 (40.43%), Postives = 56/94 (59.57%), Query Frame = 2
Query:  107 QAAITCGQVDSFLAPCLAYLT-GEGKPSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            ++AI+C  V   L PC++YLT G G P   CC GV+ L   T T+AD++AAC+CIK  A     +K + A+ L   CG  + V  +P +DC+ +
Sbjct:   23 ESAISCSVVLQDLQPCVSYLTSGSGNPPETCCDGVKSLAAATTTSADKKAACQCIKSVANSVT-VKPELAQALASNCGASLPVDASPTVDCTTV 115          
BLAST of DC900390 vs. ExPASy Swiss-Prot
Match: NLTP1_AMAHP (Non-specific lipid-transfer protein 1 OS=Amaranthus hypochondriacus PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 6.104e-14
Identity = 35/93 (37.63%), Postives = 52/93 (55.91%), Query Frame = 2
Query:  113 AITCGQVDSFLAPCLAYLTGEGK--PSRACCTGVEYLKDNTPTTADRQAACKCIKDAATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI 385
            A+TC  V   L PC+ YL G G   P   CC GV  LK    T ADR+ AC C+K AA + + +    A +L  +CGV +   ++P+++C+ +
Sbjct:    1 AVTCTVVTKALGPCMTYLKGTGATPPPANCCAGVRSLKAAAQTVADRRMACNCMKSAAQKTKSLNYKVAARLASQCGVRMSYSVSPNVNCNSV 93          
The following BLAST results are available for this feature:
BLAST of DC900390 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 82
Match NameE-valueIdentityDescription
NLTP3_ARATH7.211e-1543.48Non-specific lipid-transfer protein 3 OS=Arabidops... [more]
NLTP_PYRCO9.417e-1539.56Non-specific lipid-transfer protein OS=Pyrus commu... [more]
NLTP3_PRUDU9.417e-1541.24Non-specific lipid-transfer protein 3 OS=Prunus du... [more]
NLTP3_BRANA9.417e-1542.39Non-specific lipid-transfer protein 3 OS=Brassica ... [more]
NLTPC_ARATH1.606e-1441.49Non-specific lipid-transfer protein 12 OS=Arabidop... [more]
SCA_LILLO2.098e-1442.39Stigma/stylar cysteine-rich adhesin OS=Lilium long... [more]
NLTP_DAUCA4.674e-1440.00Non-specific lipid-transfer protein OS=Daucus caro... [more]
NLTP_AMACA6.104e-1437.63Non-specific lipid-transfer protein OS=Amaranthus ... [more]
NLTP8_ARATH6.104e-1440.43Non-specific lipid-transfer protein 8 OS=Arabidops... [more]
NLTP1_AMAHP6.104e-1437.63Non-specific lipid-transfer protein 1 OS=Amaranthu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900390 VSS Citrus sinensis cDNA clone VS28963 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900390 ID=DC900390|Name=DC900390|organism=Citrus sinensis|type=EST|length=603bp
AAACACCAAACACCTTCAAAATCCTCCAGCATTATTAGAAAACATGAAAG
CCGGTGTGGTTCTTGCTGTGATGTTACTGGCAGCGATCGTCATGGTGGAG
CGAGGCCAGGCAGCTATAACCTGCGGCCAAGTCGACTCCTTTCTAGCTCC
TTGCTTGGCATATCTGACCGGGGAAGGCAAGCCATCTCGGGCATGCTGCA
CTGGTGTCGAGTATCTGAAAGACAACACTCCAACAACTGCAGACAGGCAA
GCTGCTTGTAAATGCATCAAAGATGCGGCAACTCGCTATCGCGGCATCAA
GCTGGACAAAGCTCGTCAACTCCCCAAAGAATGTGGCGTCGACATCGGCG
TTCCCATCACCCCCGATATCGACTGTAGCAAAATTTCTTAGAACCCCCCA
CGGAGGCTTTGAGCTTGTGCGTTGAATAAACATCTCTGCCAGCTGGAGAA
AACACAGCACAATTAATATACATGAGCTAATTAAGCTTGTTAATTTATGC
TGCTTGTTATGGTTCTTGCTGAAGAACTTTTTGTATCGGGATACTTTTAG
TGCATGGTGTTTTAGCACATAATTAGCGTTAATAAAACGAGAGTTATTAC
CTC
back to top