DC900387

Overview
NameDC900387
Unique NameDC900387
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length699
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1707..2408. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_PONAB (Fructose-bisphosphate aldolase B OS=Pongo abelii GN=ALDOB PE=2 SV=3)

HSP 1 Score: 116.316 bits (290), Expect = 7.097e-29
Identity = 60/116 (51.72%), Postives = 71/116 (61.21%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP + FLSGG SEE+AT NLNA+N     KPW LSFS+GRALQ S L AW GK  N +  Q AF+ R  AN +A  G Y      G  + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSFSYGRALQASALAAWGGKAANKEATQEAFMKRAVANHQAAKGQYVHTGSSGAASTQSLFTACYTY 364          

HSP 2 Score: 30.4166 bits (67), Expect = 7.097e-29
Identity = 16/23 (69.57%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNMVT G     K TPE
Sbjct:  225 EGTLLKPNMVTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_SCHMA (Fructose-bisphosphate aldolase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 9.242e-29
Identity = 61/114 (53.51%), Postives = 79/114 (69.30%), Query Frame = 2
Query:   89 TVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGD--AQLGEGAAESLHVKDYKY 424
            TVRALQRT+P AVP + FLSGGQSE +AT+NLN +N++   KPW+L+FSFGRALQ S L  W GK+ENV  AQ   L   KAN  A +G ++G+    LG+   +SL V ++ Y
Sbjct:  253 TVRALQRTVPPAVPGITFLSGGQSELDATKNLNEINKIPGPKPWALTFSFGRALQASVLATWKGKKENVHAAQEELLKLAKANGAAAVGKFEGNMGTTLGD---KSLFVANHAY 363          

HSP 2 Score: 30.0314 bits (66), Expect = 9.242e-29
Identity = 15/23 (65.22%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKV-TPE 72
            EGTLLKPNMVT G    K  TP+
Sbjct:  225 EGTLLKPNMVTAGQACKKAYTPQ 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_CHICK (Fructose-bisphosphate aldolase C (Fragment) OS=Gallus gallus GN=ALDOC PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 9.420e-29
Identity = 59/116 (50.86%), Postives = 76/116 (65.52%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AVP V FLSGGQSEEEA+ NLNA+N     +PW+L+FS+GRALQ S L AW G+ +N   A   F+ R + N  A LG Y+G       A +SL+V ++ Y
Sbjct:   22 IAMATVTALRRTVPPAVPGVTFLSGGQSEEEASINLNAINTCPLVRPWALTFSYGRALQASALSAWRGQRDNANAATEEFVKRAEVNGLAALGKYEGSGDDSGAAGQSLYVANHAY 137          

HSP 2 Score: 29.261 bits (64), Expect = 9.420e-29
Identity = 14/20 (70.00%), Postives = 15/20 (75.00%), Query Frame = 1
Query:   16 LLKPNMVTPGSEAP-KVTPE 72
            LLKPNMVTPG   P K +PE
Sbjct:    1 LLKPNMVTPGHSCPTKYSPE 20          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF2_PLABA (Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 4.501e-28
Identity = 64/112 (57.14%), Postives = 78/112 (69.64%), Query Frame = 2
Query:   89 TVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            TVR L+RT+P A+P V FLSGGQSEE+A+ NLN++N L    PW+L+FS+GRALQ S L  W GK+ENV KA+   L R +ANS AT G YKG A  G  A  SL+ K Y Y
Sbjct:  249 TVRTLRRTVPPALPGVAFLSGGQSEEDASINLNSINVLGPH-PWALTFSYGRALQASVLNTWQGKKENVAKARRVLLQRAEANSLATYGKYKGGAG-GSTAGASLYEKKYVY 358          

HSP 2 Score: 26.1794 bits (56), Expect = 4.501e-28
Identity = 12/24 (50.00%), Postives = 14/24 (58.33%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAPKVTPEGD 78
            EG  LKPNMVT G +  + T   D
Sbjct:  221 EGASLKPNMVTAGYDCTEKTKTDD 244          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOB_RAT (Fructose-bisphosphate aldolase B OS=Rattus norvegicus GN=Aldob PE=1 SV=2)

HSP 1 Score: 114.39 bits (285), Expect = 5.858e-28
Identity = 58/116 (50.00%), Postives = 72/116 (62.07%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL RT+PAAVP++ FLSGG SEE+AT NLNA+ +    +PW LSFS+GRALQ S L AW GK  N +  Q AF+ R  AN +A  G Y      G  + +SL    Y Y
Sbjct:  249 VAMATVTALHRTVPAAVPSICFLSGGMSEEDATLNLNAIYRCPLPRPWKLSFSYGRALQASALAAWGGKAANKKATQEAFMKRAVANCQAAQGQYVHTGSSGAASTQSLFTASYTY 364          

HSP 2 Score: 29.261 bits (64), Expect = 5.858e-28
Identity = 15/23 (65.22%), Postives = 16/23 (69.57%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSE-APKVTPE 72
            EGTLLKPNM+T G     K TPE
Sbjct:  225 EGTLLKPNMLTAGHACTKKYTPE 247          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDOC_CARAU (Fructose-bisphosphate aldolase C OS=Carassius auratus GN=aldoc PE=2 SV=2)

HSP 1 Score: 112.464 bits (280), Expect = 9.929e-28
Identity = 62/122 (50.82%), Postives = 77/122 (63.11%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            K   + IA  TV AL+RT+P AV  V FLSGGQSEEEA+ NLNA+N     KPW+L+FS+GRALQ S L AW G +EN + A   FL R +AN  A  G Y      G  A +SL+V ++ Y
Sbjct:  243 KFSNQEIAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLNAINNCPLTKPWALTFSYGRALQASALSAWRGVKENEKAATEEFLKRAEANGLAAQGKYVSSGMDG-SAGQSLYVANHAY 363          

HSP 2 Score: 30.4166 bits (67), Expect = 9.929e-28
Identity = 13/17 (76.47%), Postives = 13/17 (76.47%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP 57
            EGTLLKPNMVT G   P
Sbjct:  225 EGTLLKPNMVTAGHSCP 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALFC2_PEA (Fructose-bisphosphate aldolase 2, chloroplastic OS=Pisum sativum PE=1 SV=2)

HSP 1 Score: 113.235 bits (282), Expect = 9.934e-28
Identity = 58/103 (56.31%), Postives = 71/103 (68.93%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGE 385
            +AE+T+  L R +P AVP ++FLSGGQSE EAT NLNAMN  K+  PW +SFS+ RALQ + LK W G  ENV+ AQ A L R K+NS A LG Y GD +  E
Sbjct:  238 VAEYTLNLLHRRIPPAVPGIMFLSGGQSEVEATLNLNAMN--KSPNPWHVSFSYARALQNTALKTWGGLPENVKAAQEALLFRAKSNSLAQLGKYIGDGESEE 338          

HSP 2 Score: 29.6462 bits (65), Expect = 9.934e-28
Identity = 12/16 (75.00%), Postives = 15/16 (93.75%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA 54
            EG LLKP+MVTPG+E+
Sbjct:  214 EGILLKPSMVTPGAES 229          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDCA_DANRE (Fructose-bisphosphate aldolase C-A OS=Danio rerio GN=aldoca PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 2.350e-26
Identity = 56/116 (48.28%), Postives = 71/116 (61.21%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            +A  TV AL+RT+P AV  V FLSGGQSEEEA+ NL+A+N  +  KPW+L+FSFGRALQ S LK W G+ EN   A   F+ R + NS A+ G Y            S ++  Y Y
Sbjct:  249 VAMATVTALRRTVPPAVTGVTFLSGGQSEEEASINLSAINNCRLVKPWALTFSFGRALQASALKTWRGQRENEAAATEEFIKRAEINSLASQGKYTVCGDSSGATGLSHYLSSYAY 364          

HSP 2 Score: 32.7278 bits (73), Expect = 2.350e-26
Identity = 14/17 (82.35%), Postives = 14/17 (82.35%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP 57
            EGTLLKPNMVTPG   P
Sbjct:  225 EGTLLKPNMVTPGHGCP 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALDCB_DANRE (Fructose-bisphosphate aldolase C-B OS=Danio rerio GN=aldocb PE=2 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 2.351e-26
Identity = 58/116 (50.00%), Postives = 73/116 (62.93%), Query Frame = 2
Query:   77 IAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTYKGDAQLGEGAAESLHVKDYKY 424
            IA  TV AL+RT+P AV  V FLSGGQSEEEA+ NLN++N     KPW L+FS+GRALQ S L AW G + N + A   F+ R +AN  A  G Y      G  A +SL+V ++ Y
Sbjct:  249 IAMATVTALRRTVPPAVSGVTFLSGGQSEEEASVNLNSINNCPLAKPWPLTFSYGRALQASALSAWRGAKSNEKAATEEFIKRAEANGLAAQGKYVSSGTCG-AAGQSLYVANHAY 363          

HSP 2 Score: 30.4166 bits (67), Expect = 2.351e-26
Identity = 13/17 (76.47%), Postives = 13/17 (76.47%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEAP 57
            EGTLLKPNMVT G   P
Sbjct:  225 EGTLLKPNMVTAGHSCP 241          
BLAST of DC900387 vs. ExPASy Swiss-Prot
Match: ALF_TRYBB (Fructose-bisphosphate aldolase, glycosomal OS=Trypanosoma brucei brucei GN=ALD PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 7.228e-25
Identity = 51/101 (50.50%), Postives = 64/101 (63.37%), Query Frame = 2
Query:   59 KLHRRVIAEHTVRALQRTMPAAVPAVVFLSGGQSEEEATRNLNAMNQLKTKKPWSLSFSFGRALQQSTLKAWAGKEENVQKAQAAFLVRCKANSEATLGTY 361
            K H   +AE+TV+ L R +P A+P V FLSGG SE  A+  LNAMN     +PW L+FS+ RALQ S +K W GKE  V+  + AF+ R K NS A LG Y
Sbjct:  253 KGHAEQVAEYTVKTLARVIPPALPGVTFLSGGLSEVMASEYLNAMNNCPLPRPWKLTFSYARALQSSAIKRWGGKESGVEAGRRAFMHRAKMNSLAQLGKY 353          

HSP 2 Score: 29.6462 bits (65), Expect = 7.228e-25
Identity = 12/16 (75.00%), Postives = 14/16 (87.50%), Query Frame = 1
Query:    7 EGTLLKPNMVTPGSEA 54
            EG LLKPNMV PG+E+
Sbjct:  235 EGCLLKPNMVVPGAES 250          
The following BLAST results are available for this feature:
BLAST of DC900387 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 58
Match NameE-valueIdentityDescription
ALDOB_PONAB7.097e-2951.72Fructose-bisphosphate aldolase B OS=Pongo abelii G... [more]
ALF_SCHMA9.242e-2953.51Fructose-bisphosphate aldolase OS=Schistosoma mans... [more]
ALDOC_CHICK9.420e-2950.86Fructose-bisphosphate aldolase C (Fragment) OS=Gal... [more]
ALF2_PLABA4.501e-2857.14Fructose-bisphosphate aldolase 2 OS=Plasmodium ber... [more]
ALDOB_RAT5.858e-2850.00Fructose-bisphosphate aldolase B OS=Rattus norvegi... [more]
ALDOC_CARAU9.929e-2850.82Fructose-bisphosphate aldolase C OS=Carassius aura... [more]
ALFC2_PEA9.934e-2856.31Fructose-bisphosphate aldolase 2, chloroplastic OS... [more]
ALDCA_DANRE2.350e-2648.28Fructose-bisphosphate aldolase C-A OS=Danio rerio ... [more]
ALDCB_DANRE2.351e-2650.00Fructose-bisphosphate aldolase C-B OS=Danio rerio ... [more]
ALF_TRYBB7.228e-2550.50Fructose-bisphosphate aldolase, glycosomal OS=Tryp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900387 VSS Citrus sinensis cDNA clone VS28960 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900387 ID=DC900387|Name=DC900387|organism=Citrus sinensis|type=EST|length=699bp
CCCTCTGAGGGTACCCTTTTGAAGCCCAACATGGTGACCCCTGGATCTGA
AGCTCCCAAAGTTACACCGGAGGGTGATTGCTGAACACACTGTCCGGGCC
CTGCAACGCACTATGCCTGCAGCAGTTCCTGCTGTTGTGTTCTTGTCTGG
TGGGCAGAGTGAGGAGGAGGCTACCCGCAACCTTAATGCCATGAACCAGC
TCAAGACGAAGAAGCCATGGTCACTTTCCTTTTCCTTTGGACGTGCACTT
CAGCAGAGCACTCTCAAGGCATGGGCTGGAAAGGAAGAGAATGTGCAGAA
GGCCCAGGCTGCTTTCCTTGTCAGGTGCAAGGCCAACTCTGAGGCTACCC
TCGGTACTTACAAGGGCGATGCCCAGCTTGGTGAAGGTGCCGCAGAGTCT
CTCCATGTCAAGGACTACAAATACTAAGCACAGTTGAAGCTTTGGGTGTT
GTGCTTTATGAACTTTATGAGAGTAAATGGCGGTATGAACATTAGGTTGG
CACATTCTCATTCATAGTTTTAGGGCTTTTTCATATTAGGTGGAGCAATA
AAAAGCTTGGGAACTTCGGTTTGAGTGGTTTTGATCAAAACTAAACTGAA
AACTGTTTATGCTTTTGTTTTTGTTTTTTTTTTCCTTTTCCCCTAATGGC
GCTAAATTTCTGTGATTTTGTCACATAATTGATAATGTTTTCTTGTGCT
back to top