DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF2_CAEEL (Fructose-bisphosphate aldolase 2 OS=Caenorhabditis elegans GN=aldo-2 PE=1 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 5.617e-51
Identity = 105/179 (58.66%), Postives = 129/179 (72.07%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLLT*DPXC 598
            DEL + A  I   GKGILAADESTGTIGKRL +IN+EN E+NR+  R+LLF TP   Q++SGVIL+EET +Q T  G+ F D+L + G++PGIK+D G V LAGT GE TTQGLD LA+R   + + G  FAKWR VL IG + PS L + ENAN LARYA ICQ NGLVP++  +  C
Sbjct:   18 DELHQIALKIVQDGKGILAADESTGTIGKRLDAINLENNETNRQKYRQLLFTTPNLNQHISGVILYEETFHQSTDKGEKFTDLLIKQGIVPGIKLDLGVVPLAGTIGEGTTQGLDKLAERAAAFKKGGCGFAKWRCVLNIGTHTPSHLGMLENANVLARYASICQANGLVPIVEPEVLC 196          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_MOUSE (Fructose-bisphosphate aldolase C OS=Mus musculus GN=Aldoc PE=1 SV=4)

HSP 1 Score: 200.29 bits (508), Expect = 7.336e-51
Identity = 106/173 (61.27%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I TPGKGILAADES G++ KRLS I VEN E NRR  R++LF     ++  + GVI F ETLYQK   G PFV  +++ G+L GIKVDKG V LAGT+GETTTQGLDGL +RC +Y + GA FAKWR VLKI    PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIALRIVTPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_BOVIN (Fructose-bisphosphate aldolase B OS=Bos taurus GN=ALDOB PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 9.581e-51
Identity = 106/172 (61.63%), Postives = 123/172 (71.51%), Query Frame = 2
Query:   68 LIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            L + A  I   GKGILAADES GT+G RL  I VEN E NRR  RELLF    ++ Q + GVILF ETLYQK   GK F D+LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + GA F KWRAVLKI    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   16 LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTVDSSVSQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLKIDNQCPSHLAIQENANTLARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_RAT (Fructose-bisphosphate aldolase C OS=Rattus norvegicus GN=Aldoc PE=1 SV=3)

HSP 1 Score: 199.519 bits (506), Expect = 1.251e-50
Identity = 106/173 (61.27%), Postives = 124/173 (71.68%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADES G++ KRLS I VEN E NRR  R++LF     ++  + GVI F ETLYQK   G PFV  ++E G+L GIKVDKG V LAGT+GETTTQGLDGL +RC +Y + GA FAKWR VLKI    PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQEKGILVGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALAILENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_MACFA (Fructose-bisphosphate aldolase C OS=Macaca fascicularis GN=ALDOC PE=2 SV=3)

HSP 1 Score: 197.978 bits (502), Expect = 3.641e-50
Identity = 104/173 (60.12%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADES G++ KRLS I VEN E NRR  R++LF     ++  + GVI F ETLYQK   G PFV  +++ G++ GIKVDKG V LAGT+GETTTQGLDGL++RC +Y + GA FAKWR VLKI    PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_HUMAN (Fructose-bisphosphate aldolase C OS=Homo sapiens GN=ALDOC PE=1 SV=2)

HSP 1 Score: 197.978 bits (502), Expect = 3.641e-50
Identity = 104/173 (60.12%), Postives = 125/173 (72.25%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADES G++ KRLS I VEN E NRR  R++LF     ++  + GVI F ETLYQK   G PFV  +++ G++ GIKVDKG V LAGT+GETTTQGLDGL++RC +Y + GA FAKWR VLKI    PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFT (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=PD_1845 PE=3 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 4.755e-50
Identity = 96/173 (55.49%), Postives = 122/173 (70.52%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            ++L + A  +   GKGI+A DES GTI KR SS+ +EN+E NRRA RELL  TP    Y+SG ILF+ET+ Q T AG PF   + E G++PGIKVDKG   LAG  GE  T+GLDGL  R ++YY+ GARFAKWRAV+ IG + PS + I+ N + LARYA +CQE GLVP++
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMAEHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINIGDDIPSGMCIDANVHALARYAALCQEQGLVPMV 176          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_RAT (Fructose-bisphosphate aldolase B OS=Rattus norvegicus GN=Aldob PE=1 SV=2)

HSP 1 Score: 197.208 bits (500), Expect = 6.210e-50
Identity = 104/173 (60.12%), Postives = 124/173 (71.68%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I   GKGILAADES GT+G RL  I VEN E NRR  RELLF    ++ Q + GVILF ETLYQK + GK F ++LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + G  F KWRAVL+I    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRISDQCPSSLAIQENANALARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_XYLFA (Probable fructose-bisphosphate aldolase class 1 OS=Xylella fastidiosa GN=XF_0826 PE=3 SV=1)

HSP 1 Score: 196.438 bits (498), Expect = 1.059e-49
Identity = 95/173 (54.91%), Postives = 122/173 (70.52%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            ++L + A  +   GKGI+A DES GTI KR SS+ +EN+E NRRA RELL  TP    Y+SG ILF+ET+ Q T AG PF   + + G++PGIKVDKG   LAG  GE  T+GLDGL  R ++YY+ GARFAKWRAV+ IG + PS + I+ N + LARYA +CQE GLVP++
Sbjct:    4 EQLAETAQAMVASGKGIIAIDESAGTIAKRFSSVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQSTKAGVPFPKYMADHGIIPGIKVDKGAYPLAGCPGELVTEGLDGLRARLEEYYKLGARFAKWRAVINIGDDIPSGMCIDANVHALARYAALCQEQGLVPMV 176          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOC_PANTR (Fructose-bisphosphate aldolase C OS=Pan troglodytes GN=ALDOC PE=2 SV=3)

HSP 1 Score: 196.438 bits (498), Expect = 1.059e-49
Identity = 103/173 (59.54%), Postives = 124/173 (71.68%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQY-LSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I  PGKGILAADES G++ KRLS I VEN E NRR  R++LF     ++  + GVI F ETLYQK   G PF+  + + G++ GIKVDKG V LAGT+GETTTQGLDGL++RC +Y + GA FAKWR VLKI    PS LAI ENAN LARYA ICQ+NG+VP++
Sbjct:   15 ELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFIRTILDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIV 187          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALF2_CAEEL5.617e-5158.66Fructose-bisphosphate aldolase 2 OS=Caenorhabditis... [more]
ALDOC_MOUSE7.336e-5161.27Fructose-bisphosphate aldolase C OS=Mus musculus G... [more]
ALDOB_BOVIN9.581e-5161.63Fructose-bisphosphate aldolase B OS=Bos taurus GN=... [more]
ALDOC_RAT1.251e-5061.27Fructose-bisphosphate aldolase C OS=Rattus norvegi... [more]
ALDOC_MACFA3.641e-5060.12Fructose-bisphosphate aldolase C OS=Macaca fascicu... [more]
ALDOC_HUMAN3.641e-5060.12Fructose-bisphosphate aldolase C OS=Homo sapiens G... [more]
ALF1_XYLFT4.755e-5055.49Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALDOB_RAT6.210e-5060.12Fructose-bisphosphate aldolase B OS=Rattus norvegi... [more]
ALF1_XYLFA1.059e-4954.91Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALDOC_PANTR1.059e-4959.54Fructose-bisphosphate aldolase C OS=Pan troglodyte... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top