DC900386

Overview
NameDC900386
Unique NameDC900386
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length652
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6745 contig Csv1_Contig6745:1022..1673. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_PONAB (Fructose-bisphosphate aldolase B OS=Pongo abelii GN=ALDOB PE=2 SV=3)

HSP 1 Score: 196.438 bits (498), Expect = 1.059e-49
Identity = 103/173 (59.54%), Postives = 124/173 (71.68%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I   GKGILAADES GT+G RL  I VEN E NRR  RE+LF    ++ Q + GVILF ETLYQK + GK F ++LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + G  F KWRAVL+I    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_HUMAN (Fructose-bisphosphate aldolase B OS=Homo sapiens GN=ALDOB PE=1 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.059e-49
Identity = 103/173 (59.54%), Postives = 124/173 (71.68%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I   GKGILAADES GT+G RL  I VEN E NRR  RE+LF    ++ Q + GVILF ETLYQK + GK F ++LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + G  F KWRAVL+I    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF2_PLABA (Fructose-bisphosphate aldolase 2 OS=Plasmodium berghei (strain Anka) GN=ALDO2 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.383e-49
Identity = 101/176 (57.39%), Postives = 130/176 (73.86%), Query Frame = 2
Query:   59 ADELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGP--NEPSQLAINENANGLARYAIICQENGLVPLL 580
            A EL + A  +   GKGILAADEST TI KR  +I +EN   NR + R+LLF T G  +++SG ILFEETL+QK  AG P V++L + G++PGIKVDKG V +  T+ E +TQGLDGLA+RC++YY+AGARFAKWRAVL I P   +P+ L+I E + GLARYA ICQ+N LVP++
Sbjct:    8 AQELAETAKKLVAAGKGILAADESTQTIKKRFDNIKIENTVQNRASYRDLLFGTKGLGKFISGAILFEETLFQKNEAGVPLVNLLHDEGIIPGIKVDKGLVSIPCTDDEKSTQGLDGLAERCKEYYKAGARFAKWRAVLVIDPAKGKPTDLSIQEVSWGLARYASICQQNKLVPIV 183          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_XANAC (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas axonopodis pv. citri GN=XAC3344 PE=3 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.383e-49
Identity = 95/173 (54.91%), Postives = 121/173 (69.94%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            ++L + A  +  PGKGI+A DEST TI KR +S+ +EN+E NRRA RELL  TP    Y+SG ILF+ET+ QKT  G PF + +   G++PGIKVDKG   LAG  GE  T+GLDGL  R ++YY  GARFAKWRAV+ IG + PS   I  N++ LARYA +CQE GLVP++
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFASVGIENIEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAEYMTAHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVINIGEDIPSGTCIEANSHALARYAALCQEQGLVPMV 176          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_XANCP (Probable fructose-bisphosphate aldolase class 1 OS=Xanthomonas campestris pv. campestris GN=XCC3185 PE=3 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.807e-49
Identity = 96/173 (55.49%), Postives = 119/173 (68.79%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            ++L + A  +  PGKGI+A DEST TI KR S + +EN E NRRA RELL  TP    Y+SG ILF+ET+ QKT  G PF   + + G++PGIKVDKG   LAG  GE  T+GLDGL  R ++YY  GARFAKWRAV+ IG + PS   I  NA+ LARYA +CQE GLVP++
Sbjct:    4 EQLAETAQAMVAPGKGIIAIDESTSTIAKRFSGVGIENTEENRRAYRELLLTTPKLSDYISGAILFDETIRQKTKDGVPFAKYMADHGIIPGIKVDKGAQPLAGMPGELVTEGLDGLRARLEEYYTLGARFAKWRAVINIGEDIPSGTCIEANAHALARYAALCQEQGLVPMV 176          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF1_CAEEL (Fructose-bisphosphate aldolase 1 OS=Caenorhabditis elegans GN=aldo-1 PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 1.807e-49
Identity = 105/175 (60.00%), Postives = 127/175 (72.57%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGL-ARYAIICQENGLVPLL 580
            DEL   A  I TPGKGILAADESTG++ KRL+SI +EN E NRR  R+LLF     L +Y+SGVI+F ET YQKT  GKPF  +L+E G++PGIKVDKG V +AGT GE TTQGLD L  RC +Y + GA+FAKWR V KI    PS  A+ E A+ L +RYA ICQ+NGLVP++
Sbjct:   14 DELRSIANAIVTPGKGILAADESTGSMDKRLNSIGLENTEENRRKYRQLLFTAGADLNKYISGVIMFHETFYQKTDDGKPFTALLQEQGIIPGIKVDKGVVPMAGTIGEGTTQGLDDLNARCAQYKKDGAQFAKWRCVHKISSTTPSVTALKEIASNLGSRYASICQQNGLVPIV 188          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_SHEEP (Fructose-bisphosphate aldolase B OS=Ovis aries GN=ALDOB PE=2 SV=2)

HSP 1 Score: 195.667 bits (496), Expect = 1.807e-49
Identity = 105/172 (61.05%), Postives = 122/172 (70.93%), Query Frame = 2
Query:   68 LIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            L + A  I   GKGILAADES GT+G RL  I VEN E NRR  RELLF    ++ Q + GVILF ETLYQK   GK F D+LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + GA F KWRAVLKI    PS LAI ENAN LARYA I Q+NGLVP++
Sbjct:   16 LSETARRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFTVDSSVSQSIGGVILFHETLYQKDGQGKLFRDILKEKGIVVGIKLDQGVAPLAGTNKETTVQGLDGLSERCAQYKKDGADFGKWRAVLKIDNQCPSHLAIQENANTLARYASIYQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_MOUSE (Fructose-bisphosphate aldolase B OS=Mus musculus GN=Aldob PE=1 SV=3)

HSP 1 Score: 195.667 bits (496), Expect = 1.807e-49
Identity = 104/173 (60.12%), Postives = 123/173 (71.10%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL + A  I   GKGILAADES GT+G RL  I VEN E NRR  RELLF    ++ Q + GVILF ETLYQK + G  F +VLKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + G  F KWRAVL+I    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELSEIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFRELLFSVDNSISQSIGGVILFHETLYQKDSQGNLFRNVLKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQNGLVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALF_DROME (Fructose-bisphosphate aldolase OS=Drosophila melanogaster GN=Ald PE=1 SV=5)

HSP 1 Score: 195.282 bits (495), Expect = 2.360e-49
Identity = 105/174 (60.34%), Postives = 122/174 (70.11%), Query Frame = 2
Query:   62 DELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCT-PGALQYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            DEL + A  I  PGKGILAADES  T+GKRL  I VEN E NRRA R+LLF T P   + +SGVILF ETLYQK   G PF ++LK+ G++ GIKVDKG V L G+  E TTQGLD LA RC +Y + G  FAKWR VLKIG N PS  +I ENAN LARYA ICQ   +VP++
Sbjct:   14 DELREIAQKIVAPGKGILAADESGPTMGKRLQDIGVENTEDNRRAYRQLLFSTDPKLAENISGVILFHETLYQKADDGTPFAEILKKKGIILGIKVDKGVVPLFGSEDEVTTQGLDDLAARCAQYKKDGCDFAKWRCVLKIGKNTPSYQSILENANVLARYASICQSQRIVPIV 187          
BLAST of DC900386 vs. ExPASy Swiss-Prot
Match: ALDOB_RABIT (Fructose-bisphosphate aldolase B OS=Oryctolagus cuniculus GN=ALDOB PE=1 SV=3)

HSP 1 Score: 194.897 bits (494), Expect = 3.082e-49
Identity = 103/173 (59.54%), Postives = 123/173 (71.10%), Query Frame = 2
Query:   65 ELIKNAAYIGTPGKGILAADESTGTIGKRLSSINVENVESNRRALRELLFCTPGAL-QYLSGVILFEETLYQKTAAGKPFVDVLKEGGVLPGIKVDKGTVELAGTNGETTTQGLDGLAQRCQKYYEAGARFAKWRAVLKIGPNEPSQLAINENANGLARYAIICQENGLVPLL 580
            EL   A  I   GKGILAADES GT+G RL  I VEN E NRR  RE+LF    ++ Q + GVILF ETLYQK + GK F ++LKE G++ GIK+D+G   LAGTN ETT QGLDGL++RC +Y + G  F KWRAVL+I    PS LAI ENAN LARYA ICQ+NGLVP++
Sbjct:   15 ELSDIAQRIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFREILFTVDNSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTNKETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANTLARYASICQQNGLVPIV 187          
The following BLAST results are available for this feature:
BLAST of DC900386 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
ALDOB_PONAB1.059e-4959.54Fructose-bisphosphate aldolase B OS=Pongo abelii G... [more]
ALDOB_HUMAN1.059e-4959.54Fructose-bisphosphate aldolase B OS=Homo sapiens G... [more]
ALF2_PLABA1.383e-4957.39Fructose-bisphosphate aldolase 2 OS=Plasmodium ber... [more]
ALF1_XANAC1.383e-4954.91Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_XANCP1.807e-4955.49Probable fructose-bisphosphate aldolase class 1 OS... [more]
ALF1_CAEEL1.807e-4960.00Fructose-bisphosphate aldolase 1 OS=Caenorhabditis... [more]
ALDOB_SHEEP1.807e-4961.05Fructose-bisphosphate aldolase B OS=Ovis aries GN=... [more]
ALDOB_MOUSE1.807e-4960.12Fructose-bisphosphate aldolase B OS=Mus musculus G... [more]
ALF_DROME2.360e-4960.34Fructose-bisphosphate aldolase OS=Drosophila melan... [more]
ALDOB_RABIT3.082e-4959.54Fructose-bisphosphate aldolase B OS=Oryctolagus cu... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900386 VSS Citrus sinensis cDNA clone VS28960 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900386 ID=DC900386|Name=DC900386|organism=Citrus sinensis|type=EST|length=652bp
ACAAAACAAATTTTCTATCTTCAAGTCGATCACCATGTCTTGCTTCAAGG
GCAAATACGCCGATGAGCTCATTAAAAATGCTGCCTACATTGGCACCCCT
GGAAAGGGTATCCTTGCTGCTGATGAGTCAACAGGCACCATTGGCAAGCG
TCTATCCAGCATCAATGTTGAGAATGTTGAGTCAAACAGGCGTGCTCTCC
GCGAGCTCCTTTTCTGCACTCCCGGTGCCCTTCAGTACCTCAGTGGTGTC
ATCCTCTTCGAGGAGACCCTCTACCAGAAGACTGCTGCTGGCAAGCCCTT
TGTTGATGTCTTGAAGGAGGGTGGAGTCCTCCCTGGAATTAAGGTTGACA
AGGGTACTGTTGAGCTTGCTGGTACCAATGGTGAGACCACCACCCAGGGT
CTTGATGGCCTCGCCCAGCGCTGCCAGAAATACTATGAAGCTGGTGCTCG
TTTTGCCAAATGGCGTGCTGTTCTTAAGATTGGCCCTAATGAGCCTTCGC
AGCTGGCCATCAATGAGAATGCCAATGGCCTGGCCCGATATGCTATCATC
TGCCAGGAGAATGGCCTTGTTCCATTGTTGACCTGAGATCCTTGNTGCGG
CCCATGCATCACAGTGTGCTGTGTACCGAGCGTGTCTGCTGATCTCAGCT
TA
back to top