DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_BOVIN (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Bos taurus GN=GNB1 PE=1 SV=3)

HSP 1 Score: 75.0998 bits (183), Expect = 6.167e-13
Identity = 45/189 (23.81%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIVTSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: YB1C_SCHPO (Uncharacterized WD repeat-containing protein C3D6.12 OS=Schizosaccharomyces pombe GN=SPBC3D6.12 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.054e-13
Identity = 58/197 (29.44%), Postives = 85/197 (43.15%), Query Frame = 3
Query:   75 HEXKLWDT--------ATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            H  KLW           T   + TL + +   +  TD       VL+V  SPDGR +A   +D T  V+ +   KF   L GH +P   +  S  D ++L + S D +V I   +      ++  H   ++ V   PD     T S DR V+ WD      +  +  H  +VW ++  P    VVS S D SI L+E
Sbjct:  499 HTVKLWSLKSSFDFVPGTTRKVTTLKLEQTRQIDFTDD------VLAVKISPDGRFVAASLLDNTVKVYYLDSLKFFLNLYGHKLPVLSMDIS-YDSKLLVTCSADKNVKIWGLDFGDCHKSIFAHQDSIMEVTFQPDTYNFFTCSKDREVRYWDGKSFDLILKLRGHHSEVWALAVGPT--FVVSGSHDHSIRLWE 686          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_XENLA (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Xenopus laevis GN=gnb1 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 8.054e-13
Identity = 44/189 (23.28%), Postives = 82/189 (43.39%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D    ++++       +    L GH        +  +D   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICPIYNLKTREGNVRVSRELAGHTGYLSCCRF--LDDNQIITSSGDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDSRCFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBLP_SCHPO (Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe GN=rkp1 PE=1 SV=3)

HSP 1 Score: 70.0922 bits (170), Expect = 8.869e-13
Identity = 44/123 (35.77%), Postives = 64/123 (52.03%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVT-RAKFLHXLEGHFMPXRXLVYSPVDPRVLF-SASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSM 545
            VLSV+ SPD R++  GS D T  ++++    K+     GH      + +SP    + F SA  D  V + D E  SL T+  GH  +V +V  SPDG+   +G  D T+ LWDLN    + S+
Sbjct:  108 VLSVSISPDNRQVVSGSRDKTIKIWNIIGNCKYTITDGGHSDWVSCVRFSPNPDNLTFVSAGWDKAVKVWDLETFSLRTSHYGHTGYVSAVTISPDGSLCASGGRDGTLMLWDLNESTHLYSL 230          

HSP 2 Score: 22.3274 bits (46), Expect = 8.869e-13
Identity = 8/15 (53.33%), Postives = 10/15 (66.67%), Query Frame = 2
Query:   74 ARGKALGHSHLESDC 118
            A+ +  GHSH  SDC
Sbjct:   55 AQRRLTGHSHFVSDC 69          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: Y143_SYNY3 (Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803) GN=slr0143 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 53/153 (34.64%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SVA S     IA  S DGT  ++   + +FL    GH      + +SP + ++  +A  D  V I D +G  L T + GH   V SV  SPDG  + + S DRTV+LW       +  +  HT  V    F P G  +VSV  D  I L++
Sbjct:  563 VTSVAISSHKNLIASASRDGTVHLW-TPQGEFLREFTGHTGSIYRVDFSP-NGKIFATAGQDQTVKIWDLDGNLLQT-LKGHQDSVYSVSFSPDGEILASTSRDRTVRLWHWRSGKTLAVLGGHTKSVDDAQFSPDGQTLVSVCRDGQIRLWD 712          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_XENTR (WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V SV +SP+G  +A  S D    ++     KF   + GH +    + +S  D  +L SAS D  + I D         + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   46 KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_RAT (WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V SV +SP+G  +A  S D    ++     KF   + GH +    + +S  D  +L SAS D  + I D         + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   46 KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_MOUSE (WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V SV +SP+G  +A  S D    ++     KF   + GH +    + +S  D  +L SAS D  + I D         + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   46 KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_HUMAN (WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V SV +SP+G  +A  S D    ++     KF   + GH +    + +S  D  +L SAS D  + I D         + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   46 KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR5_BOVIN (WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 44/148 (29.73%), Postives = 71/148 (47.97%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V SV +SP+G  +A  S D    ++     KF   + GH +    + +S  D  +L SAS D  + I D         + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   46 KAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 192          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
GBB1_BOVIN6.167e-1323.81Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
YB1C_SCHPO8.054e-1329.44Uncharacterized WD repeat-containing protein C3D6.... [more]
GBB1_XENLA8.054e-1323.28Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBLP_SCHPO8.869e-1335.77Guanine nucleotide-binding protein subunit beta-li... [more]
Y143_SYNY31.052e-1234.64Uncharacterized WD repeat-containing protein slr01... [more]
WDR5_XENTR1.052e-1229.73WD repeat-containing protein 5 OS=Xenopus tropical... [more]
WDR5_RAT1.052e-1229.73WD repeat-containing protein 5 OS=Rattus norvegicu... [more]
WDR5_MOUSE1.052e-1229.73WD repeat-containing protein 5 OS=Mus musculus GN=... [more]
WDR5_HUMAN1.052e-1229.73WD repeat-containing protein 5 OS=Homo sapiens GN=... [more]
WDR5_BOVIN1.052e-1229.73WD repeat-containing protein 5 OS=Bos taurus GN=WD... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top