DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TUP12_SCHPO (Transcriptional repressor tup12 OS=Schizosaccharomyces pombe GN=tup12 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.052e-12
Identity = 50/162 (30.86%), Postives = 79/162 (48.77%), Query Frame = 3
Query:  156 TDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            + K     +V SVA+SPDG+ +A G  D    ++D+ + +    L GH      L +S  D + L S S D  V + D E       +      V +V  SPDG  I  GS D+ +++W  +    ++ +  H + V+ V+F P G  +VS S D +I L+E
Sbjct:  328 SSKREGDLYVRSVAFSPDGKYLATGVEDQQIRIWDIAQKRVYRLLTGHEQEIYSLDFSK-DGKTLVSGSGDRTVCLWDVEAGEQKLILHTD-DGVTTVMFSPDGQFIAAGSLDKVIRIW-TSSGTLVEQLHGHEESVYSVAFSPDGKYLVSGSLDNTIKLWE 486          

HSP 2 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 47/166 (28.31%), Postives = 76/166 (45.78%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDA------------EGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEY 644
            V +V +SPDG+ IA GS+D    ++  +    +  L GH      + +SP D + L S S D  + + +             EG       +GH  ++LSV  SPDG  I +GS DRT++ W  +   +  ++  H + V  V+  P G    + S D    ++ Y
Sbjct:  420 VTTVMFSPDGQFIAAGSLDKVIRIW-TSSGTLVEQLHGHEESVYSVAFSP-DGKYLVSGSLDNTIKLWELQCVSNVAPSMYKEGGICKQTFTGHKDFILSVTVSPDGKWIISGSKDRTIQFWSPDSPHSQLTLQGHNNSVISVAVSPNGHCFATGSGDLRARIWSY 583          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBLP_DICDI (Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.374e-12
Identity = 53/179 (29.61%), Postives = 76/179 (42.46%), Query Frame = 3
Query:  147 LKPTDKXSSKK----------FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXT--AMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            L PTD  S  K          FV  V  S DG+    GS D T  ++D+T+       +GH      + +S  D R + S S D  + + +  G+   T      H  WV  +  SP+   I +GS D  VK+WD+       ++T+HT  V  V+  P G    S   D    L+E S
Sbjct:   51 LTPTDATSPGKAHRSLKGHSHFVQDVVISHDGQFALSGSWDNTLRLWDITKGVSTRLFKGHTQDVMSVAFSS-DNRQIISGSRDATIKVWNTLGECKFTLEGPEAHQDWVSCIRFSPNTPTIVSGSWDNKVKIWDIKSFKCNHTLTDHTGYVNTVTISPDGSLCASGGKDTFACLWELS 228          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB3_RAT (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Rattus norvegicus GN=Gnb3 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.374e-12
Identity = 49/192 (25.52%), Postives = 83/192 (43.23%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVF-------DVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WDT T N +  + +                +V++ A++P G  +ACG +D   S++       +V  ++ L    G+    R L     D   + ++S DT   + D E     T   GH    +S+  SPD     +G+ D + KLWD+      Q+ T H   +  + F P G  + + SDD S  L++
Sbjct:   81 VWDTYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFL-----DDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDYKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB3_MOUSE (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Mus musculus GN=Gnb3 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.374e-12
Identity = 49/192 (25.52%), Postives = 83/192 (43.23%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFD-------VTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WDT T N +  + +                +V++ A++P G  +ACG +D   S+++       V  ++ L    G+    R L     D   + ++S DT   + D E     T   GH    +S+  SPD     +G+ D + KLWD+      Q+ T H   +  + F P G  + + SDD S  L++
Sbjct:   81 VWDTYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFL-----DDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDYKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB3_CANFA (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Canis familiaris GN=GNB3 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 1.374e-12
Identity = 49/192 (25.52%), Postives = 83/192 (43.23%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVF-------DVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WDT T N +  + +                +V++ A++P G  +ACG +D   S++       +V  ++ L    G+    R L     D   + ++S DT   + D E     T   GH    +S+  SPD     +G+ D + KLWD+      Q+ T H   +  + F P G  + + SDD S  L++
Sbjct:   81 VWDTYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNMCSIYSLKSREGNVKVSRELSAHTGYLSCCRFL-----DDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFKLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_XENTR (WD repeat-containing protein 69 OS=Xenopus tropicalis GN=wdr69 PE=2 SV=1)

HSP 1 Score: 73.559 bits (179), Expect = 1.794e-12
Identity = 45/156 (28.85%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYS-----PVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +VA++  G     GS D T  V+D    + LH LEGH    R +VY+     P   ++  + S D    +  AE         GH   ++ +  +P    I TGS D T KLWD+       +++ H  ++  +SF   G R+++ S D ++S++E
Sbjct:   97 NVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGH----RNVVYAIQFNNPYGDKIA-TGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 247          

HSP 2 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 46/187 (24.60%), Postives = 82/187 (43.85%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWS-PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K+WDTA+   + TL                +  V ++ ++ P G +IA GS D T  ++     K  H   GH      L ++P    ++ + S DT   + D +       +SGHA  ++S+  +  G  + TGS D TV +W++     + ++  H  ++    F      + + S DKS  L++
Sbjct:  117 KVWDTASGEELHTLE-------------GHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLAFNP-QSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD 289          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NLE1_MOUSE (Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=2 SV=3)

HSP 1 Score: 73.559 bits (179), Expect = 1.794e-12
Identity = 47/165 (28.48%), Postives = 79/165 (47.88%), Query Frame = 3
Query:  147 LKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKF-LHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            LK   + +S ++ L     P+  R+  GS D T  ++     K  L  + GH      +++SP D R++ SAS D  + + D        ++ GH   V  +  S D   + +GSSD T+K+WD+  +     +  H D+V+ V + P G RV S   DK + ++
Sbjct:  322 LKELKERASSRYNLVRGQGPE--RLVSGSDDFTLFLWSPAEDKKPLARMTGHQALINQVLFSP-DSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLATDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDS_DROME (Protein will die slowly OS=Drosophila melanogaster GN=wds PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 46/149 (30.87%), Postives = 77/149 (51.68%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXD-AEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDD 620
            K V +V +SP+G  +A  S D    ++     KF   + GH +    + +S  D R+L S S D  + + + + GKSL T + GH+ +V   + +P    I +GS D +V++WD+     ++++  H+D V  V F   G  +VS S D
Sbjct:   73 KAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSS-DSRLLVSGSDDKTLKVWELSTGKSLKT-LKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYD 219          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_XENLA (WD repeat-containing protein 69 OS=Xenopus laevis GN=wdr69 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 45/156 (28.85%), Postives = 74/156 (47.44%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYS-----PVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +VA++  G     GS D T  V+D    + LH LEGH    R +VY+     P   ++  + S D    +  AE         GH   ++ +  +P    I TGS D T KLWD+       +++ H  ++  +SF   G R+++ S D ++S++E
Sbjct:   97 NVAFNKSGSSFITGSYDRTCKVWDTASGEELHTLEGH----RNVVYAIQFNNPYGDKIA-TGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLVFNPQSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWE 247          

HSP 2 Score: 72.4034 bits (176), Expect = 3.997e-12
Identity = 47/187 (25.13%), Postives = 83/187 (44.39%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWS-PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K+WDTA+   + TL                +  V ++ ++ P G +IA GS D T  ++     K  H   GH      LV++P    ++ + S DT   + D +       +SGHA  ++S+  +  G  + TGS D TV +W++     + ++  H  ++    F      + + S DKS  L++
Sbjct:  117 KVWDTASGEELHTLE-------------GHRNVVYAIQFNNPYGDKIATGSFDKTCKLWSAETGKCYHTFRGHTAEIVCLVFNP-QSTLIATGSMDTTAKLWDIQSGEEALTLSGHAAEIISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFNWDCSLIATASMDKSCKLWD 289          

HSP 3 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 46/186 (24.73%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KLWD  +     TLS    E             ++S++++  G R+  GS D T SV+++   + +H L GH        ++  D  ++ +AS D    + D+        ++GH   VL V     G  + T S+D T +++  + R  +  +  H  ++  + F   G R+V+ S DK+  L++
Sbjct:  202 KLWDIQSGEEALTLSGHAAE-------------IISLSFNTTGDRLITGSFDHTVSVWEIPSGRRIHTLIGHRGEISSAQFN-WDCSLIATASMDKSCKLWDSLNGKCVATLTGHDDEVLDVTFDSTGQLVATASADGTARVYSASSRKCLAKLEGHEGEISKICFNAQGNRIVTASSDKTSRLWD 373          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: REC14_SCHPO (Meiotic recombination protein rec14 OS=Schizosaccharomyces pombe GN=rec14 PE=2 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 42/167 (25.15%), Postives = 73/167 (43.71%), Query Frame = 3
Query:  138 PEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            P   K ++  +  KF L + +SP+GR I  G   G   +      +  H L GH  P R + +SP    +L +A     + I D         + GHA W+ +V  +P G  + +   +  +K+WD++    + + +     +W V++   G   +    DKSI  Y
Sbjct:  133 PSDCKISELDTKGKFGLCIDYSPNGRFIVSGHQTGQLFLISTETGRLFHVLSGHTSPVRSVAFSP-GSTLLAAAGDSKMITIYDVLSGDQVGQLRGHAAWIFAVAFNPVGDLLLSADVEGKIKIWDIDTMECISTQSETDGAIWAVAWYKNG--FIVAGADKSIRWY 296          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
TUP12_SCHPO1.052e-1230.86Transcriptional repressor tup12 OS=Schizosaccharom... [more]
GBLP_DICDI1.374e-1229.61Guanine nucleotide-binding protein subunit beta-li... [more]
GBB3_RAT1.374e-1225.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB3_MOUSE1.374e-1225.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB3_CANFA1.374e-1225.52Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
WDR69_XENTR1.794e-1228.85WD repeat-containing protein 69 OS=Xenopus tropica... [more]
NLE1_MOUSE1.794e-1228.48Notchless protein homolog 1 OS=Mus musculus GN=Nle... [more]
WDS_DROME2.343e-1230.87Protein will die slowly OS=Drosophila melanogaster... [more]
WDR69_XENLA2.343e-1228.85WD repeat-containing protein 69 OS=Xenopus laevis ... [more]
REC14_SCHPO2.343e-1225.15Meiotic recombination protein rec14 OS=Schizosacch... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top