DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NLE1_PONAB (Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 42/133 (31.58%), Postives = 71/133 (53.38%), Query Frame = 3
Query:  120 TLSIXRP-EGLKPTDKXSSKKFVLS-VAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            TL +  P E  KP  + +  + +++ V +SPD R +A  S D +  ++D    K+L  L GH      + +S  D R+L S S D+ + + D + + L   + GHA  V +VD SPDG  + +G  D+ +++W
Sbjct:  352 TLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWS-ADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          

HSP 2 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 42/142 (29.58%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  216 RIACGSMDGTXSVFDVTRAKF-LHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            R+  GS D T  ++     K  L  + GH      +++SP D R++ SAS D  + + D        ++ GH   V  +  S D   + +GSSD T+K+WD+  +     +  H D+V+ V + P G RV S   DK + ++
Sbjct:  343 RLVSGSDDFTLFLWSPAEDKKPLTRMTGHQALINQVLFSP-DSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NLE1_HUMAN (Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 42/133 (31.58%), Postives = 71/133 (53.38%), Query Frame = 3
Query:  120 TLSIXRP-EGLKPTDKXSSKKFVLS-VAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            TL +  P E  KP  + +  + +++ V +SPD R +A  S D +  ++D    K+L  L GH      + +S  D R+L S S D+ + + D + + L   + GHA  V +VD SPDG  + +G  D+ +++W
Sbjct:  352 TLFLWSPAEDKKPLTRMTGHQALINQVLFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWS-ADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          

HSP 2 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 42/142 (29.58%), Postives = 69/142 (48.59%), Query Frame = 3
Query:  216 RIACGSMDGTXSVFDVTRAKF-LHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            R+  GS D T  ++     K  L  + GH      +++SP D R++ SAS D  + + D        ++ GH   V  +  S D   + +GSSD T+K+WD+  +     +  H D+V+ V + P G RV S   DK + ++
Sbjct:  343 RLVSGSDDFTLFLWSPAEDKKPLTRMTGHQALINQVLFSP-DSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDSTLKVWDVKAQKLAMDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIW 483          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_MOUSE (Katanin p80 WD40-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 50/153 (32.68%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV  +     I  GS  G+  V+D+  AK L  L GH      L + P    V  S S DT++ + D   K       GH+  V  +  SPDG  + + + D TVKLWDL     M     HT  V  V F P    + S S D++I  ++
Sbjct:   66 VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVA-SGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWD 217          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_HUMAN (Katanin p80 WD40-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 50/153 (32.68%), Postives = 68/153 (44.44%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV  +     I  GS  G+  V+D+  AK L  L GH      L + P    V  S S DT++ + D   K       GH+  V  +  SPDG  + + + D TVKLWDL     M     HT  V  V F P    + S S D++I  ++
Sbjct:   66 VESVRLNTPEELIVAGSQSGSIRVWDLEAAKILRTLMGHKANICSLDFHPYGEFVA-SGSQDTNIKLWDIRRKGCVFRYRGHSQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKMMSEFPGHTGPVNVVEFHPNEYLLASGSSDRTIRFWD 217          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_CRIGR (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Cricetulus griseus GN=GNB1 PE=2 SV=3)

HSP 1 Score: 73.1738 bits (178), Expect = 2.343e-12
Identity = 44/189 (23.28%), Postives = 83/189 (43.92%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++++       +    L GH        +  ++   + ++S DT   + D E     T  +GH   V+S+  +PD     +G+ D + KLWD+      Q+ T H   +  + F P G    + SDD +  L++
Sbjct:   81 IWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELAGHTGYLSCCRF--LNDNQIVTSSEDTTCALWDIETGQQTTTFTGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_CAEEL (Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis elegans GN=gpb-1 PE=2 SV=2)

HSP 1 Score: 72.7886 bits (177), Expect = 3.060e-12
Identity = 46/189 (24.34%), Postives = 82/189 (43.39%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S D    + D E     TA +GH   V+S+  SPD     +G+ D + KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 VWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRTFISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_CAEBR (Guanine nucleotide-binding protein subunit beta-1 OS=Caenorhabditis briggsae GN=gpb-1 PE=3 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 3.060e-12
Identity = 46/189 (24.34%), Postives = 82/189 (43.39%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  +D   + ++S D    + D E     TA +GH   V+S+  SPD     +G+ D + KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 VWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGSFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--LDDNQIVTSSGDMTCALWDIETGQQCTAFTGHTGDVMSLSLSPDFRTFISGACDASAKLWDIRDGMCKQTFPGHESDINAVAFFPSGNAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR3_MOUSE (WD repeat-containing protein 3 OS=Mus musculus GN=Wdr3 PE=2 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.997e-12
Identity = 47/165 (28.48%), Postives = 77/165 (46.67%), Query Frame = 3
Query:  147 LKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +K T      + VL V++SP+ + +A   +D T  VF V   KF   L GH +P   +  S  D  ++ + S D +V I   +      ++  H   V+ +   P      T   D  +K WD +    +Q++  H  ++W ++  P G  VVS S DKS+ L+E
Sbjct:  539 VKQTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKVFYVDTLKFFLSLYGHKLPVLCMDISH-DGALIATGSADRNVKIWGLDFGDCHRSLFAHDDSVMYLRFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSASHDKSLRLWE 702          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: YCW2_YEAST (WD repeat-containing protein YCR072C OS=Saccharomyces cerevisiae GN=YCR072C PE=1 SV=3)

HSP 1 Score: 72.0182 bits (175), Expect = 5.220e-12
Identity = 40/113 (35.40%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            +K V  VA+SPDGR I   S D +  ++D    KF+    GH      + +S  D R+L S S DT + + D   + L   + GH   V +VD S DG  + +G  D+ V+LW
Sbjct:  402 QKLVNHVAFSPDGRYIVSASFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSS-DCRLLVSCSKDTTLKVWDVRTRKLSVDLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLW 513          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: UTP12_YEAST (U3 small nucleolar RNA-associated protein 12 OS=Saccharomyces cerevisiae GN=DIP2 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.220e-12
Identity = 45/153 (29.41%), Postives = 72/153 (47.06%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +L V  SPD R +A   +D T  VF +   KF   L GH +P   +  S  D +++ ++S D ++ I   +      ++  H   +++V   P      + S D  VK WD      +Q +  H  +VW ++    GG VVS S D SI ++E
Sbjct:  534 ILCVRVSPDDRYLAISLLDNTVKVFFLDSMKFYLSLYGHKLPVLSIDIS-FDSKMIITSSADKNIKIWGLDFGDCHKSLFAHQDSIMNVKFLPQSHNFFSCSKDAVVKYWDGEKFECIQKLYAHQSEVWALAVATDGGFVVSSSHDHSIRIWE 685          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
NLE1_PONAB2.343e-1231.58Notchless protein homolog 1 OS=Pongo abelii GN=NLE... [more]
NLE1_HUMAN2.343e-1231.58Notchless protein homolog 1 OS=Homo sapiens GN=NLE... [more]
KTNB1_MOUSE2.343e-1232.68Katanin p80 WD40-containing subunit B1 OS=Mus musc... [more]
KTNB1_HUMAN2.343e-1232.68Katanin p80 WD40-containing subunit B1 OS=Homo sap... [more]
GBB1_CRIGR2.343e-1223.28Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
GBB1_CAEEL3.060e-1224.34Guanine nucleotide-binding protein subunit beta-1 ... [more]
GBB1_CAEBR3.060e-1224.34Guanine nucleotide-binding protein subunit beta-1 ... [more]
WDR3_MOUSE3.997e-1228.48WD repeat-containing protein 3 OS=Mus musculus GN=... [more]
YCW2_YEAST5.220e-1235.40WD repeat-containing protein YCR072C OS=Saccharomy... [more]
UTP12_YEAST5.220e-1229.41U3 small nucleolar RNA-associated protein 12 OS=Sa... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top