DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PRP46_KLULA (Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces lactis GN=PRP46 PE=3 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.220e-12
Identity = 44/145 (30.34%), Postives = 65/145 (44.83%), Query Frame = 3
Query:  207 DGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            D    A GS D T  ++D+   K    L GH M  R +  S   P  +FSAS D  V   D E  +      GH   V +VD  P    I T   D  V+LWD+  R+ +  +  H   +  V   P+  +++S S D ++ L++
Sbjct:  134 DNEWFATGSNDTTIKIWDLAAGKLKITLIGHVMSVRDIAISKRHP-YMFSASEDKLVKCWDLERNTAIRDFHGHLSGVHTVDVHPSLDIIATAGRDAVVRLWDIRSRSEIMVLPGHKSPINKVKCLPVDPQIISCSGDATVRLWD 277          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB3_HUMAN (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3 OS=Homo sapiens GN=GNB3 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 5.220e-12
Identity = 48/192 (25.00%), Postives = 83/192 (43.23%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFD-------VTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S+++       V  ++ L    G+    R L     D   + ++S DT   + D E     T   GH    +S+  SPD     +G+ D + KLWD+      Q+ T H   +  + F P G  + + SDD S  L++
Sbjct:   81 VWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGNFVACGGLDNMCSIYNLKSREGNVKVSRELSAHTGYLSCCRFL-----DDNNIVTSSGDTTCALWDIETGQQKTVFVGHTGDCMSLAVSPDFNLFISGACDASAKLWDVREGTCRQTFTGHESDINAICFFPNGEAICTGSDDASCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR3_HUMAN (WD repeat-containing protein 3 OS=Homo sapiens GN=WDR3 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 46/165 (27.88%), Postives = 77/165 (46.67%), Query Frame = 3
Query:  147 LKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +K T      + VL V++SP+ + +A   +D T  +F V   KF   L GH +P   +  S  D  ++ + S D +V I   +      ++  H   V+ +   P      T   D  +K WD +    +Q++  H  ++W ++  P G  VVS S DKS+ L+E
Sbjct:  540 VKQTRTLQLDEDVLCVSYSPNQKLLAVSLLDCTVKIFYVDTLKFFLSLYGHKLPVICMDISH-DGALIATGSADRNVKIWGLDFGDCHKSLFAHDDSVMYLQFVPKSHLFFTAGKDHKIKQWDADKFEHIQTLEGHHQEIWCLAVSPSGDYVVSSSHDKSLRLWE 703          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TUP1_KLULA (General transcriptional corepressor TUP1 OS=Kluyveromyces lactis GN=TUP1 PE=1 SV=2)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 55/165 (33.33%), Postives = 81/165 (49.09%), Query Frame = 3
Query:  168 SSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASP-DGAAITTGSSDRTVKLWDLNMRAAMQSM-------TNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            SS  ++ SV +SPDG+ +A G+ D    ++D+   K +  L+GH      L Y P   + L S S D  V I D    +    +S     V +V  SP +G  I  GS DRTV++WD +    ++ +       T H D V+ V F   G  VVS S D+S+ L+
Sbjct:  404 SSDLYIRSVCFSPDGKFLATGAEDKLIRIWDLETKKIVMTLKGHEQDIYSLDYFPSGNK-LVSGSGDRTVRIWDLTTGTCSLTLS-IEDGVTTVAVSPGEGKFIAAGSLDRTVRVWDSDTGFLVERLDSENELGTGHRDSVYSVVFTRDGKGVVSGSLDRSVKLW 566          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PFS2_EMENI (Polyadenylation factor subunit 2 OS=Emericella nidulans GN=pfs2 PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 49/195 (25.13%), Postives = 83/195 (42.56%), Query Frame = 3
Query:  171 SKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLE-------------------GHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS***GIFKVRLLQSFCLL 698
            SKK +  V W+P+GRR+  G   G   +++ T   F   ++                    H    R L +SP D + L SAS DT + I D   ++  T ++GH   V S D  P    + +GS D  VK WD      + ++ +H + V    F  +   +++ S     +         +F +R+++  C+L
Sbjct:   93 SKKPITVVRWTPEGRRLLTGGHTGEFMLWNGTAFNFETVMDKGDVKYWRPNFNNVETIDDAHHDAVRDLAWSPSDTKFL-SASDDTTLKIYDFTARTCDTVLTGHNWDVKSCDWHPTKGLLVSGSKDHQVKFWDPRTARCLTTLHSHKNTVTATKFSRVNNNLLATSSRDQTA--------RVFDLRMMRDICIL 278          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PF20_CHLRE (Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 3
Query:  291 EGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +GH +    L   P  P +L +AS D    +    G  L     GH  WV  VD  P G  + +G  D  VK+WD   +  + + T+H   +W V F  LG  V S S D ++ L++
Sbjct:  323 KGHLLSVANLALHPTKP-ILVTASDDKTWKMWHMPGGDLIMCGEGHKDWVAGVDFHPAGTCLASGGGDSAVKIWDFEKQRCVTTFTDHKQAIWSVRFHHLGEVVASGSLDHTVRLWD 438          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NLE1_ARATH (Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 40/113 (35.40%), Postives = 61/113 (53.98%), Query Frame = 3
Query:  174 KKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLW 512
            ++ V  V +SPDG+ IA  S D +  +++    +F+    GH  P   + +S  D R+L S S D+ + I +   K L   + GHA  V +VD SPDG  + +G  DR +KLW
Sbjct:  360 QQLVNHVYFSPDGKWIASASFDKSVRLWNGITGQFVTVFRGHVGPVYQVSWS-ADSRLLLSGSKDSTLKIWEIRTKKLKQDLPGHADEVFAVDWSPDGEKVVSGGKDRVLKLW 471          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_XENLA (Katanin p80 WD40-containing subunit B1 OS=Xenopus laevis GN=katnb1 PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 46/153 (30.07%), Postives = 69/153 (45.10%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            V SV ++     I  GS  G+  ++D+  AK L  L GH      L + P    V  S S DT++ + D   K       GH   V  +  SPDG  + + S D +VKLWDL     M  ++ H   V  + F P    + S S D+++  ++
Sbjct:   66 VESVRFNNSEELIVAGSQSGSLRIWDLEAAKILRTLMGHKANVSSLDFHPYGEFVA-SGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWLASASDDHSVKLWDLTAGKMMAELSEHKGPVNIIEFHPNEYLLASGSADRTVRFWD 217          

HSP 2 Score: 69.3218 bits (168), Expect = 3.384e-11
Identity = 40/144 (27.78%), Postives = 67/144 (46.53%), Query Frame = 3
Query:  210 GRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            GR +A G  D    ++ V +   +  L GH  P   + ++  +  ++ + S    + I D E   +   + GH   V S+D  P G  + +GS D  +KLWD+  +  +     HT  V  + F P G  + S SDD S+ L++
Sbjct:   33 GRLVATGGDDCRVHLWSVNKPNCIMSLTGHTTPVESVRFNNSE-ELIVAGSQSGSLRIWDLEAAKILRTLMGHKANVSSLDFHPYGEFVASGSLDTNIKLWDVRRKGCVFRYKGHTQAVRCLRFSPDGKWLASASDDHSVKLWD 175          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: GBB1_HOMAM (Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1 OS=Homarus americanus GN=GBETA1 PE=2 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 6.818e-12
Identity = 46/189 (24.34%), Postives = 82/189 (43.39%), Query Frame = 3
Query:   87 LWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVT----RAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +WD+ T N +  + +                +V++ A++P G  +ACG +D   S++ +       +    L GH        +  VD   + ++S D    + D E     T  +GH   V+S+  SP+    T+G+ D + KLWD+      Q+   H   +  V+F P G    + SDD +  L++
Sbjct:   81 VWDSYTTNKVHAIPLR-------------SSWVMTCAYAPSGSYVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRF--VDDNQIVTSSGDMTCALWDIETGQQCTQFTGHTGDVMSLSLSPNMRTFTSGACDASAKLWDIRDGMCRQTFPGHESDINAVTFFPNGHAFATGSDDATCRLFD 254          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_HUMAN (WD repeat-containing protein 69 OS=Homo sapiens GN=WDR69 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 40/152 (26.32%), Postives = 72/152 (47.37%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            + S +++ D   I  GSMD T  ++D T  K +  L GH        +     +++ +AS D    I  A  +     + GH   +  +  +P G  + TGSSD+T ++WD      +Q +  HTD+++  +F   G  V++ S D +  ++
Sbjct:  264 ISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTG-KLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNHLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGNIVITGSKDNTCRIW 414          

HSP 2 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 50/187 (26.74%), Postives = 83/187 (44.39%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWS-PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KLWDTA+   + TL                +  V ++A++ P G +IA GS D T  ++ V   K  H   GH      L ++P    V  + S DT   + D +       + GH+  ++S+  +  G  I TGS D TV +WD +    +  +  H  ++   SF      +++ S DK+  L++
Sbjct:  117 KLWDTASGEELNTLE-------------GHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVA-TGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRIITGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWD 289          

HSP 3 Score: 69.3218 bits (168), Expect = 3.384e-11
Identity = 39/152 (25.66%), Postives = 74/152 (48.68%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            ++ ++++P    +A GSMD T  ++D+   + ++ L GH      L ++    R++ + S D  V + DA+       + GH   + S   + D + I TGS D+T KLWD      + ++T H D++    F   G  + + S D +  ++
Sbjct:  180 IVCLSFNPQSTLVATGSMDTTAKLWDIQNGEEVYTLRGHSAEIISLSFNTSGDRII-TGSFDHTVVVWDADTGRKVNILIGHCAEISSASFNWDCSLILTGSMDKTCKLWDATNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIF 330          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
PRP46_KLULA5.220e-1230.34Pre-mRNA-splicing factor PRP46 OS=Kluyveromyces la... [more]
GBB3_HUMAN5.220e-1225.00Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
WDR3_HUMAN6.818e-1227.88WD repeat-containing protein 3 OS=Homo sapiens GN=... [more]
TUP1_KLULA6.818e-1233.33General transcriptional corepressor TUP1 OS=Kluyve... [more]
PFS2_EMENI6.818e-1225.13Polyadenylation factor subunit 2 OS=Emericella nid... [more]
PF20_CHLRE6.818e-1231.62Flagellar WD repeat-containing protein Pf20 OS=Chl... [more]
NLE1_ARATH6.818e-1235.40Notchless protein homolog OS=Arabidopsis thaliana ... [more]
KTNB1_XENLA6.818e-1230.07Katanin p80 WD40-containing subunit B1 OS=Xenopus ... [more]
GBB1_HOMAM6.818e-1224.34Guanine nucleotide-binding protein G(I)/G(S)/G(T) ... [more]
WDR69_HUMAN8.904e-1226.32WD repeat-containing protein 69 OS=Homo sapiens GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top