DC900382

Overview
NameDC900382
Unique NameDC900382
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length905
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900382_ssr1 microsatellite DC900382_ssr1:1..58. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_BOVIN (WD repeat-containing protein 69 OS=Bos taurus GN=WDR69 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 38/151 (25.17%), Postives = 70/151 (46.36%), Query Frame = 3
Query:  189 SVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +VA +  G     GS D T  ++D    + LH LEGH      + ++      + + S D    +   E         GH   ++ +  +P    + TGS D T KLWD+     + ++T H+ ++  +SF   G R+++ S D +++++E
Sbjct:   97 NVALNKSGSCFITGSYDRTCKLWDTASGEELHTLEGHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVATGSMDTTAKLWDIQSGEEVFTLTGHSAEIISLSFNTSGNRIITGSFDHTVTVWE 247          

HSP 2 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 39/152 (25.66%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            + S  ++ D   I  GSMD T  ++D    K +  L GH        +     +++ +AS D    I  A  +   T + GH   +  +  +P G  + TGSSD+T ++WD      +Q +  HTD+++  +F   G  +++ S D +  ++
Sbjct:  264 ISSAVFNWDCSLILTGSMDKTCKLWDAVNGKCVATLTGHDDEILDSCFDYTG-KLIATASADGTARIFSAATRECVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCAFNYKGDIIITGSKDNTCRIW 414          

HSP 3 Score: 68.9366 bits (167), Expect = 4.419e-11
Identity = 48/187 (25.67%), Postives = 84/187 (44.92%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWS-PDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KLWDTA+   + TL                +  V ++A++ P G +IA GS D T  ++ V   K  H   GH      L ++P    V  + S DT   + D +       ++GH+  ++S+  +  G  I TGS D TV +W+ +    + ++  H  ++    F      +++ S DK+  L++
Sbjct:  117 KLWDTASGEELHTLE-------------GHRNVVYAIAFNNPYGDKIATGSFDKTCKLWSVETGKCYHTFRGHTAEIVCLSFNPQSTLVA-TGSMDTTAKLWDIQSGEEVFTLTGHSAEIISLSFNTSGNRIITGSFDHTVTVWEADTGRKVYTLIGHCAEISSAVFNWDCSLILTGSMDKTCKLWD 289          

HSP 4 Score: 68.1662 bits (165), Expect = 7.538e-11
Identity = 44/186 (23.66%), Postives = 84/186 (45.16%), Query Frame = 3
Query:   84 KLWDTATWNLIATLSIXRPEGLKPTDKXSSKKFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            KLWD  +   + TL+    E             ++S++++  G RI  GS D T +V++    + ++ L GH       V++  D  ++ + S D    + DA        ++GH   +L       G  I T S+D T +++    R  +  +  H  ++  +SF P G R+++ S DK+  +++
Sbjct:  202 KLWDIQSGEEVFTLTGHSAE-------------IISLSFNTSGNRIITGSFDHTVTVWEADTGRKVYTLIGHCAEISSAVFN-WDCSLILTGSMDKTCKLWDAVNGKCVATLTGHDDEILDSCFDYTGKLIATASADGTARIFSAATRECVTKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWD 373          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PRP46_CRYNE (Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neoformans GN=PRP46 PE=3 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 8.904e-12
Identity = 44/154 (28.57%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +V +VA  P  +  A G+ D    ++D+   +    L GH    R L  S   P  LFS + D  V   D E   +     GH   V S+   P    + TG  D +V++WD+  RA + ++T HT  V  V  +    +++S S D ++ L++
Sbjct:  184 WVRAVAMDPGNQWFATGAGDRVIKIWDLASGELKLSLTGHISTIRGLAVSDRHP-YLFSCAEDKMVKCWDLETNKVIRHYHGHFSGVYSLSVHPTLDVLVTGGRDASVRVWDMRTRANIFTLTGHTSTVGDVKTQDSDPQIISGSMDSTVRLWD 336          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: TBL3_BOVIN (Transducin beta-like protein 3 OS=Bos taurus GN=TBL3 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 43/155 (27.74%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  177 KFVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            K + SVA +P+ + +A GS D T  ++ + R + L    GH      + +SP+D +VL +AS D  + +   +  S      GH   VL V     G  + +  SD  +KLW +     ++++  H D+VWG+    L  R ++ + D  + L++
Sbjct:  480 KDINSVAVAPNDKLLATGSQDRTAKLWALPRCQLLGTFSGHRRGLWCVQFSPMD-QVLATASADGTIKLWALQDFSCLKTFEGHDASVLKVAFVSRGTQLLSSGSDGLLKLWTIKNNECVRTLDAHEDKVWGLHCSRLDDRALTGASDSRVVLWK 633          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: NUDF_CRYNE (Nuclear distribution protein PAC1 OS=Cryptococcus neoformans GN=PAC1 PE=3 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 44/123 (35.77%), Postives = 61/123 (49.59%), Query Frame = 3
Query:  282 HXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWD-LNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYEYS 647
            H L  H  P   L + P    +L SAS D  V + D E   +   + GH   V+ VD  P G  + T SSD T+KLWD  N    ++++  H   V  V F P G  +VS S DK+I +++ S
Sbjct:   99 HTLASHRAPVTRLAFHPTWT-LLASASEDATVKLWDWEAGDMERTLKGHTKAVMDVDFDPRGGLMATCSSDLTLKLWDTANQYTNVKTLHGHDHSVSSVRFMPDGETLVSASRDKTIRVWQVS 220          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: KTNB1_CHICK (Katanin p80 WD40-containing subunit B1 OS=Gallus gallus GN=KATNB1 PE=2 SV=2)

HSP 1 Score: 70.8626 bits (172), Expect = 1.163e-11
Identity = 39/144 (27.08%), Postives = 69/144 (47.92%), Query Frame = 3
Query:  210 GRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            GR +A G  D   +V+ V +   +  L GH  P   L  S  +  ++ + S    + + D E   +   + GH   + S+D  P G+ + +GS D  +KLWD+  +  +    +HT  V  + F P G  + S +DD ++ L++
Sbjct:   33 GRLLATGGDDCRVNVWSVNKPNCVMSLTGHTTPIESLQISAKE-ELIVAGSQSGSIRVWDLEAAKILRTLLGHKANICSLDFHPYGSFVASGSLDTDIKLWDVRRKGCIFKYKSHTQAVRCLRFSPDGKWLASAADDHTVKLWD 175          

HSP 2 Score: 70.0922 bits (170), Expect = 1.984e-11
Identity = 46/141 (32.62%), Postives = 62/141 (43.97%), Query Frame = 3
Query:  219 IACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            I  GS  G+  V+D+  AK L  L GH      L + P    V  S S DT + + D   K        H   V  +  SPDG  + + + D TVKLWDL     M   T H+  V  V F P    + S S D++I  ++
Sbjct:   78 IVAGSQSGSIRVWDLEAAKILRTLLGHKANICSLDFHPYGSFVA-SGSLDTDIKLWDVRRKGCIFKYKSHTQAVRCLRFSPDGKWLASAADDHTVKLWDLTAGKVMFEFTGHSGPVNVVEFHPSEYLLASGSSDRTIRFWD 217          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: WDR69_MACFA (WD repeat-containing protein 69 OS=Macaca fascicularis GN=WDR69 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 40/152 (26.32%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  183 VLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            + S  ++ D   I  GSMD T  ++D T  K +  L GH        +     +++ +AS D    I  A  +     + GH   +  +  +P G  + TGSSD+T ++WD      +Q +  HTD+++  +F   G  V++ S D +  ++
Sbjct:  264 ISSALFNWDCSLILTGSMDKTCMLWDATNGKCVATLTGHDDEILDSCFDYTG-KLIATASADGTARIFSAATRKCIAKLEGHEGEISKISFNPQGNRLLTGSSDKTARIWDAQTGQCLQVLEGHTDEIFSCTFNYKGNIVITGSKDNTCRIW 414          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PRP46_YARLI (Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolytica GN=PRP46 PE=3 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 43/153 (28.10%), Postives = 69/153 (45.10%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLY 638
            +V SV   P+ +  A GS D T  ++D+   K    L GH M  R L  SP  P  +FS   D  V   D E   +     GH   V S+D  P    + +   D   ++WD+  R  +  ++ H   +  V F+    +V++ S D+++ L+
Sbjct:  134 WVRSVCVEPENQWFATGSADKTIKIWDLATGKLRLTLTGHIMGVRALGVSPRHP-YMFSGGEDKMVKCWDLETNKVVRHYHGHLSAVYSLDIHPTLDVLVSAGRDAVARVWDIRTRDPVVVLSGHKSTINRVKFQASEPQVITASADETVRLW 285          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PRP46_ASHGO (Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii GN=PRP46 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 44/145 (30.34%), Postives = 67/145 (46.21%), Query Frame = 3
Query:  207 DGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            D    A GS D T  V+D+   K    L+GH M  R +  S   P  +FSAS D  V   D E  ++     G    V SVD  P    I +   D  V++WD+  R+ + ++  H   +  V   P+  ++VS S D ++ L++
Sbjct:  125 DNAWFATGSNDSTIRVWDLATGKLKVTLQGHIMTVRDICISARHP-YMFSASQDKLVKCWDLERNTVVRDFHGTLSGVHSVDLHPSLDLIVSAGRDSVVRVWDIRSRSCVLTLAGHRGPINKVRCLPVDPQIVSCSTDATVKLWD 268          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PLRG1_RAT (Pleiotropic regulator 1 OS=Rattus norvegicus GN=Plrg1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 42/154 (27.27%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +V  +A  P  +    GS D T  ++D+   K    L GH    R ++ S   P  LFS   D  V   D E   +     GH   V  +D  P    + T S D T ++WD+  +A++ +++ HT+ V  V  +    ++++ S D +I L++
Sbjct:  206 WVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSP-YLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTIDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 358          
BLAST of DC900382 vs. ExPASy Swiss-Prot
Match: PLRG1_MOUSE (Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.519e-11
Identity = 42/154 (27.27%), Postives = 71/154 (46.10%), Query Frame = 3
Query:  180 FVLSVAWSPDGRRIACGSMDGTXSVFDVTRAKFLHXLEGHFMPXRXLVYSPVDPRVLFSASXDTHVHIXDAEGKSLXTAMSGHAXWVLSVDASPDGAAITTGSSDRTVKLWDLNMRAAMQSMTNHTDQVWGVSFRPLGGRVVSVSDDKSISLYE 641
            +V  +A  P  +    GS D T  ++D+   K    L GH    R ++ S   P  LFS   D  V   D E   +     GH   V  +D  P    + T S D T ++WD+  +A++ +++ HT+ V  V  +    ++++ S D +I L++
Sbjct:  205 WVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSP-YLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWD 357          
The following BLAST results are available for this feature:
BLAST of DC900382 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 138
Match NameE-valueIdentityDescription
WDR69_BOVIN8.904e-1225.17WD repeat-containing protein 69 OS=Bos taurus GN=W... [more]
PRP46_CRYNE8.904e-1228.57Pre-mRNA-splicing factor PRP46 OS=Cryptococcus neo... [more]
TBL3_BOVIN1.163e-1127.74Transducin beta-like protein 3 OS=Bos taurus GN=TB... [more]
NUDF_CRYNE1.163e-1135.77Nuclear distribution protein PAC1 OS=Cryptococcus ... [more]
KTNB1_CHICK1.163e-1127.08Katanin p80 WD40-containing subunit B1 OS=Gallus g... [more]
WDR69_MACFA1.519e-1126.32WD repeat-containing protein 69 OS=Macaca fascicul... [more]
PRP46_YARLI1.519e-1128.10Pre-mRNA-splicing factor PRP46 OS=Yarrowia lipolyt... [more]
PRP46_ASHGO1.519e-1130.34Pre-mRNA-splicing factor PRP46 OS=Ashbya gossypii ... [more]
PLRG1_RAT1.519e-1127.27Pleiotropic regulator 1 OS=Rattus norvegicus GN=Pl... [more]
PLRG1_MOUSE1.519e-1127.27Pleiotropic regulator 1 OS=Mus musculus GN=Plrg1 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900382 VSS Citrus sinensis cDNA clone VS28955 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900382 ID=DC900382|Name=DC900382|organism=Citrus sinensis|type=EST|length=905bp
TCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTC
TCTCTCTCCTCGTGCCGAATTCGGCACGAGGNAAAGCTCTGGGACACAGC
CACTTGGAATCTGATTGCCACCCTGTCAATTNCTCGNCCAGAAGGACTGA
AGCCGACAGATAAAAGNAGCAGCAAGAAGTTTGTTCTATCAGTTGCATGG
AGTCCTGATGGCAGACGAATTGCTTGTGGNTCAATGGATGGCACAATNTC
TGTTTTTGATGTTACCCGCGCCAAATTCCTGCATNATCTGGAAGGCCATT
TCATGCCTGNGCGTNCTCTTGTTTATTCCCCTGTTGATCCACGTGTNCTC
TTCTCTGCATCANATGATACTCATGTGCACATTNATGATGCTGAGGGTAA
AAGTCTGGNTACGGCAATGTCTGGTCATGCTAGNTGGGTGTTGAGTGTTG
ATGCAAGCCCCGATGGAGCAGCTATTACAACAGGCTCAAGTGATAGAACT
GTAAAGCTCTGGGATCTTAACATGAGAGCAGCCATGCAGTCAATGACTAA
CCACACAGACCAGGTCTGGGGAGTGTCATTTAGACCACTAGGAGGTCGGG
TTGTTAGCGTATCAGATGACAAAAGCATATCACTCTATGAATACTCCTGA
TGATAAGGCATTTTCAAAGTAAGACTATTGCAAAGTTTTTGTTTGTTATT
TGAAAATGCTAATGCTATTGTTGTTCTTAACTGCATTGGTCTGAAATTGT
ATGCCNTTCCAACCTANATTAGTCTTCNGCNTANCNTGNTTTTTTGANCA
TTTTCATCATCTNAAAAAANCCGACATTTGGNGGACTGATGTCTAGTAGT
TGNGCNCAAGTAGTTGGCATGGTGGTAAAGTGNCTTCCCCCTTTGCTTTG
GATGC
back to top