DC900381

Overview
NameDC900381
Unique NameDC900381
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length656
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10814 contig Csv1_Contig10814:273..927. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R1_MOUSE (Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 8.245e-14
Identity = 36/66 (54.55%), Postives = 48/66 (72.73%), Query Frame = 1
Query:   37 GRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRR 225
            G VCISILHPP DDP   EL SERW P   V +I+LS+IS+L+ PN  SPANV+A+   ++W++ +
Sbjct:   90 GDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESK 155          

HSP 2 Score: 21.557 bits (44), Expect = 8.245e-14
Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3
Query:    6 EIWHPNVY 29
            ++WHPN+Y
Sbjct:   80 KMWHPNIY 87          
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R1_HUMAN (Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2)

HSP 1 Score: 76.2554 bits (186), Expect = 8.245e-14
Identity = 36/66 (54.55%), Postives = 48/66 (72.73%), Query Frame = 1
Query:   37 GRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRR 225
            G VCISILHPP DDP   EL SERW P   V +I+LS+IS+L+ PN  SPANV+A+   ++W++ +
Sbjct:   90 GDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESK 155          

HSP 2 Score: 21.557 bits (44), Expect = 8.245e-14
Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3
Query:    6 EIWHPNVY 29
            ++WHPN+Y
Sbjct:   80 KMWHPNIY 87          
The following BLAST results are available for this feature:
BLAST of DC900381 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 22
Match NameE-valueIdentityDescription
UB2R1_MOUSE8.245e-1454.55Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus... [more]
UB2R1_HUMAN8.245e-1454.55Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900381 VSS Citrus sinensis cDNA clone VS28953 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900381 ID=DC900381|Name=DC900381|organism=Citrus sinensis|type=EST|length=656bp
CACCAGAGATTTGGCATCCTAATGTCTATCCGGAATGGGCGTGTCTGCAT
ATCAATCCTTCATCCTCCAGGTGACGACCCTAATGGATATGAGCTTGCAA
GTGAGCGCTGGATGCCTGTTCATACTGTTGAAAGTATCGTTTTGAGTATC
ATATCAATGCTTTCCGGTCCTAATGATGAATCTCCTGCAAATGTCGAAGC
TGCAAAAGAATGGAGAGACAGGAGAGATGACTTCAAGAAGAAAGTAGGCC
NCTGTGTGAGAAGATCNCAAGAAATGTTGTAATCCAACTGCAGGCACTCT
TTTTTTCTCTACCTATGTGTTTGTACGGGAAATGTCTTGATTTAATTGTG
TGGGGGGAACTGGGTTCTGTGGGTAATGTCAATGTGCTTGGTCTTGTGTA
GACTGGCATTTTGAAGTTCTCTCAACCATCTCTCTCGTTTTCTCTGCATG
GTCAAGTCNCTGTAACGACTGGGAACATCCATGTATTCAAAAGCGNNNTT
TGGTTAGTTTTAATCNCAAATGTTCTGTCATTCTCTTAAGTTCGTGTGGA
GATTGCTCTACTCAGAATGGCTTGTGGTTTGATTTCAAAAGGATTCCCCC
GTGATATTTGCTGCTTTTGAATCTTACCGAGCCCNCAAGCATTAGATGTT
TTCTTT
back to top