DC900381
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Alignments
Homology
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R1_MOUSE (Ubiquitin-conjugating enzyme E2 R1 OS=Mus musculus GN=Cdc34 PE=1 SV=1) HSP 1 Score: 76.2554 bits (186), Expect = 8.245e-14 Identity = 36/66 (54.55%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 37 GRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRR 225 G VCISILHPP DDP EL SERW P V +I+LS+IS+L+ PN SPANV+A+ ++W++ + Sbjct: 90 GDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESK 155 HSP 2 Score: 21.557 bits (44), Expect = 8.245e-14 Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3 Query: 6 EIWHPNVY 29 ++WHPN+Y Sbjct: 80 KMWHPNIY 87
BLAST of DC900381 vs. ExPASy Swiss-Prot
Match: UB2R1_HUMAN (Ubiquitin-conjugating enzyme E2 R1 OS=Homo sapiens GN=CDC34 PE=1 SV=2) HSP 1 Score: 76.2554 bits (186), Expect = 8.245e-14 Identity = 36/66 (54.55%), Postives = 48/66 (72.73%), Query Frame = 1 Query: 37 GRVCISILHPPGDDPNGYELASERWMPVHTVESIVLSIISMLSGPNDESPANVEAA---KEWRDRR 225 G VCISILHPP DDP EL SERW P V +I+LS+IS+L+ PN SPANV+A+ ++W++ + Sbjct: 90 GDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESK 155 HSP 2 Score: 21.557 bits (44), Expect = 8.245e-14 Identity = 5/8 (62.50%), Postives = 8/8 (100.00%), Query Frame = 3 Query: 6 EIWHPNVY 29 ++WHPN+Y Sbjct: 80 KMWHPNIY 87 The following BLAST results are available for this feature:
BLAST of DC900381 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 22
Pages
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >DC900381 ID=DC900381; Name=DC900381; organism=Citrus sinensis; type=EST; length=656bpback to top |