DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_LITLI (60S ribosomal protein L26 OS=Littorina littorea GN=RPL26 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 3.349e-36
Identity = 75/106 (70.75%), Postives = 91/106 (85.85%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            MK+N  VSS R KNRK HF APS +RR +MS+P+S +LRQKYN RSMP+RKDDEVQVVRG +KG++ GKVVQVYR+K+V+HIERI REK NG+TV VGI+PSKV+I
Sbjct:    1 MKFNKMVSSDRGKNRKRHFNAPSHMRRKIMSSPMSKELRQKYNCRSMPIRKDDEVQVVRGHFKGQQVGKVVQVYRKKFVVHIERIQREKANGATVYVGIHPSKVLI 106          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_SCHPO (60S ribosomal protein L26 OS=Schizosaccharomyces pombe GN=rpl26 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 3.134e-34
Identity = 68/106 (64.15%), Postives = 91/106 (85.85%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK++  V+SSRRK RKAHF APSSVRR+LMSAPLS +LR++Y +RS+PVR+DD++ V+RG+ KGREGK+  VYR+K+++ IER+TREK NG++  VGI+ SKVVIT
Sbjct:    1 MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRGSNKGREGKITSVYRKKFLLLIERVTREKANGASAPVGIDASKVVIT 106          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_CHICK (60S ribosomal protein L26 (Fragment) OS=Gallus gallus GN=RPL26 PE=2 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 2.246e-32
Identity = 68/90 (75.56%), Postives = 82/90 (91.11%), Query Frame = 1
Query:  106 HFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGRE-GKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            HF APS +RR +MS+PLS +LRQKYNVRSMP+RKDDEVQVVRG YKG++ GKVVQVYR+K+VI+IER+ REK NG+TV+VGI+PSKVVIT
Sbjct:    1 HFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIHPSKVVIT 90          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_DICDI (60S ribosomal protein L26 OS=Dictyostelium discoideum GN=rpl26 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.004e-32
Identity = 68/106 (64.15%), Postives = 83/106 (78.30%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK N  VSSSRRK+RKAHFTA S  RRI MSA LS DLR KYNVRS+P+RKDDEV+VV G  K  EGKVV  YR+K+VIHI+++T  K NG+T  +G++PS V++T
Sbjct:    1 MKRNTNVSSSRRKSRKAHFTASSGERRIRMSAALSHDLRTKYNVRSLPIRKDDEVRVVCGDNKNHEGKVVACYRKKYVIHIDKLTVTKTNGNTAQIGVSPSNVILT 106          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_CAEEL (60S ribosomal protein L26 OS=Caenorhabditis elegans GN=rpl-26 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 8.535e-32
Identity = 65/106 (61.32%), Postives = 86/106 (81.13%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            MK NP VSS   K+RKAHF APS  RR +MSAPL+ +LR K+ +R++P+R DDEV V+RG +KG  G+V++ YR+K+VIHI++ITREK NGSTV++GI+PSKV IT
Sbjct:    1 MKVNPFVSSDSGKSRKAHFNAPSHERRRIMSAPLTKELRTKHGIRAIPIRTDDEVVVMRGRHKGNTGRVLRCYRKKFVIHIDKITREKANGSTVHIGIHPSKVAIT 106          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26B_YEAST (60S ribosomal protein L26-B OS=Saccharomyces cerevisiae GN=RPL26B PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 1.363e-29
Identity = 58/100 (58.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VSS RRK RKA+FTAPSS RR+L+SAPLS +LR +Y ++++P+R+DDEV VVRG+ KG+EGK+  VYR K+ + ++++T+EKVNG++V + ++PSK+VIT
Sbjct:    8 VSSDRRKARKAYFTAPSSERRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26A_YEAST (60S ribosomal protein L26-A OS=Saccharomyces cerevisiae GN=RPL26A PE=1 SV=3)

HSP 1 Score: 129.798 bits (325), Expect = 1.363e-29
Identity = 58/100 (58.00%), Postives = 85/100 (85.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VSS RRK RKA+FTAPSS RR+L+SAPLS +LR +Y ++++P+R+DDEV VVRG+ KG+EGK+  VYR K+ + ++++T+EKVNG++V + ++PSK+VIT
Sbjct:    8 VSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRHO (50S ribosomal protein L24P OS=Pyrococcus horikoshii GN=rpl24p PE=3 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.394e-20
Identity = 52/105 (49.52%), Postives = 74/105 (70.48%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            MK N   S   RK RK  + AP  VR+ +MSAPLS +LR+KY VR++PVR  D+V+++RG +KG EGKVV+V  +++ I++E +T  KVNG+ V   I+PS V+I
Sbjct:    1 MKMN---SKQPRKQRKFLYNAPLHVRQKMMSAPLSKELREKYKVRNLPVRVGDKVRIMRGDFKGYEGKVVEVDLKRYRIYVEGVTLRKVNGTEVFYPIHPSNVMI 102          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRFU (50S ribosomal protein L24P OS=Pyrococcus furiosus GN=rpl24p PE=3 SV=2)

HSP 1 Score: 97.8265 bits (242), Expect = 5.738e-20
Identity = 50/98 (51.02%), Postives = 69/98 (70.41%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S   RK RK  + AP  VR+ LMSAPLS +LR+KY VR++PVR  D+V+++RG YKG EGKVV+V  +++ I++E  T  K NG+ V   I+PS V+I
Sbjct:    5 SKQPRKQRKFLYNAPLHVRQKLMSAPLSRELREKYKVRNLPVRVGDKVRIMRGDYKGHEGKVVEVDLKRYRIYVEGATLRKTNGTEVFYPIHPSNVMI 102          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRKO (50S ribosomal protein L24P OS=Pyrococcus kodakaraensis GN=rpl24p PE=3 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 4.858e-19
Identity = 46/94 (48.94%), Postives = 69/94 (73.40%), Query Frame = 1
Query:   88 RKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            RK RK  + AP  +R  +MSAPLS +LR+KY VR++P+R  D+V+V+RG +KG EGKVV+V  R++ IH+E +T +K +G+ V   ++PS V+I
Sbjct:    9 RKQRKFLYNAPLHLRGKIMSAPLSKELREKYGVRNLPIRVGDKVKVMRGDFKGVEGKVVEVDLRRYRIHVEGVTHKKTDGTEVFYPLHPSNVMI 102          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL26_LITLI3.349e-3670.7560S ribosomal protein L26 OS=Littorina littorea GN... [more]
RL26_SCHPO3.134e-3464.1560S ribosomal protein L26 OS=Schizosaccharomyces p... [more]
RL26_CHICK2.246e-3275.5660S ribosomal protein L26 (Fragment) OS=Gallus gal... [more]
RL26_DICDI5.004e-3264.1560S ribosomal protein L26 OS=Dictyostelium discoid... [more]
RL26_CAEEL8.535e-3261.3260S ribosomal protein L26 OS=Caenorhabditis elegan... [more]
RL26B_YEAST1.363e-2958.0060S ribosomal protein L26-B OS=Saccharomyces cerev... [more]
RL26A_YEAST1.363e-2958.0060S ribosomal protein L26-A OS=Saccharomyces cerev... [more]
RL24_PYRHO4.394e-2049.5250S ribosomal protein L24P OS=Pyrococcus horikoshi... [more]
RL24_PYRFU5.738e-2051.0250S ribosomal protein L24P OS=Pyrococcus furiosus ... [more]
RL24_PYRKO4.858e-1948.9450S ribosomal protein L24P OS=Pyrococcus kodakarae... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top