DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METST (50S ribosomal protein L24P OS=Methanosphaera stadtmanae (strain DSM 3091) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.481e-15
Identity = 42/100 (42.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            +S   RK RKA +TAP   R   MS  LS DL++++N RS PVRK D V++VRG ++G EGKV  V  + + + ++  + +K +GS +   I+PS +V+T
Sbjct:    1 MSKQPRKQRKALYTAPLHKRHNSMSVHLSDDLKEEFNRRSFPVRKGDSVEIVRGDFRGTEGKVEGVDLKNYRVLVDGASSQKQDGSKLYQPIHPSNLVLT 100          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_META3 (50S ribosomal protein L24P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 9.481e-15
Identity = 42/98 (42.86%), Postives = 62/98 (63.27%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S   RK RKA + AP   R  LMSA LS DL++KYN  ++PV+  D V+++RGT+KG EG+V +V  + + I++E     K +G+     I+PS V+I
Sbjct:    6 SKQPRKQRKALYNAPLHARNKLMSAMLSKDLKEKYNKNALPVKTGDTVKILRGTFKGIEGEVSKVDYKSYKIYVEGAVNRKQDGNESLYPIHPSNVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METJA (50S ribosomal protein L24P OS=Methanocaldococcus jannaschii GN=rpl24p PE=3 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.238e-14
Identity = 41/98 (41.84%), Postives = 65/98 (66.33%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S   RK RKA F AP  +RR +MSA LS +L++K    ++PVRK D V+++RG +KG EG+V++V  +++ I++E    ++ +G  V   I+PS V+I
Sbjct:    6 SKQPRKQRKALFNAPLHLRRKVMSAMLSKELKEKLGKNAIPVRKGDVVRIMRGDFKGLEGEVIKVDLKRYRIYVEGANNKRQDGREVPYPIHPSNVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRAR (50S ribosomal protein L24P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.617e-14
Identity = 44/98 (44.90%), Postives = 61/98 (62.24%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S+  RK R A F AP  +R  L +A LS +L +K  V+ +PVR+ D V ++RG +KG  GKVV+V  +K  I++E  TR    G TV   I+PSKV+I
Sbjct:    6 SAQPRKQRLALFNAPLHLRHKLFNAKLSPELEKKLGVKRLPVRRGDTVMILRGDFKGVTGKVVRVDLKKVRIYVEGATRTNSRGQTVYYPIHPSKVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_THEPD (50S ribosomal protein L24P OS=Thermofilum pendens (strain Hrk 5) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 79.337 bits (194), Expect = 2.112e-14
Identity = 45/100 (45.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:   76 SSSRRKNRKAH-FTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            SS   K RK   + AP  +R   + APLS +L+QK  ++ + VRK D V +VRG++KG EGKV  V  +K  IH+E  T  K +G+ V   I+PSKVV+T
Sbjct:    6 SSKPGKVRKREVYDAPLHIRSKKIVAPLSAELQQKLGIKRIRVRKGDRVLIVRGSFKGHEGKVTSVDVKKGRIHVEGATLRKADGTEVPFPIHPSKVVVT 105          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRIL (50S ribosomal protein L24P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.758e-14
Identity = 42/94 (44.68%), Postives = 61/94 (64.89%), Query Frame = 1
Query:   88 RKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            R+ R + +TAP  +R  L +A LS DL++K  V+ +PVR+ D V ++RG +KG  GKVV+V  +K  I++E  TR    G TV   I+PSKV+I
Sbjct:   10 RRQRLSLYTAPLHLRHKLFNAKLSPDLQKKLGVKRLPVRRGDTVMIMRGDFKGVTGKVVKVDLKKVRIYVEGATRTNSKGQTVYYPIHPSKVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METM7 (50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.758e-14
Identity = 41/99 (41.41%), Postives = 64/99 (64.65%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S   RK RKA + AP  +R  +M+A LS +L++K+N  S+PV+K D V+V+RG +KG EG+V +V    + I +E +  +K +G+     I+PS V+IT
Sbjct:    6 SKQPRKQRKALYNAPLHLRNSVMAAMLSKELKEKFNKNSLPVKKGDTVKVLRGNFKGIEGEVSKVDYAGYKIIVEGVVNKKQDGTETAYPIHPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METM5 (50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.758e-14
Identity = 41/99 (41.41%), Postives = 64/99 (64.65%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S   RK RKA + AP  +R  +M+A LS +L++K+N  S+PV+K D V+V+RG +KG EG+V +V    + I +E +  +K +G+     I+PS V+IT
Sbjct:    6 SKQPRKQRKALYNAPLHLRNSVMAAMLSKELKEKFNKNSLPVKKGDTVKVLRGNFKGIEGEVSKVDYAGYKIIVEGVVNKKQDGTETAYPIHPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_SULSO (50S ribosomal protein L24P OS=Sulfolobus solfataricus GN=rpl24p PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.705e-14
Identity = 44/100 (44.00%), Postives = 64/100 (64.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS    K RK  +T P   R+ L+ A +S D+  +Y ++ + VRK D V+V+RG   G+EGKVV+V  +   + IE ITR+KV+G+ V V I+ SKV+IT
Sbjct:    2 VSLKPSKQRKLLYTLPLHQRKKLLVAKVSDDIASQYGIKRIRVRKGDTVRVMRGGNSGKEGKVVEVNTKTGRLAIEGITRKKVDGTPVYVWIHASKVMIT 101          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRAE (50S ribosomal protein L24P OS=Pyrobaculum aerophilum GN=rpl24p PE=3 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.705e-14
Identity = 42/98 (42.86%), Postives = 63/98 (64.29%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S+  RK R++ + AP  +RR L +A LS +L +K  V+ +PVR+ D V ++RG +KG  GKVV+V  ++  I++E  TR    G TV   I+PSKV+I
Sbjct:    6 SAQPRKQRRSLYKAPLHLRRKLFNAKLSPELAKKLGVKRLPVRRGDTVLILRGDFKGVTGKVVKVDLKRVRIYVEGATRTNSRGQTVYYPIHPSKVMI 103          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL24_METST9.481e-1542.0050S ribosomal protein L24P OS=Methanosphaera stadt... [more]
RL24_META39.481e-1542.8650S ribosomal protein L24P OS=Methanococcus aeolic... [more]
RL24_METJA1.238e-1441.8450S ribosomal protein L24P OS=Methanocaldococcus j... [more]
RL24_PYRAR1.617e-1444.9050S ribosomal protein L24P OS=Pyrobaculum arsenati... [more]
RL24_THEPD2.112e-1445.0050S ribosomal protein L24P OS=Thermofilum pendens ... [more]
RL24_PYRIL2.758e-1444.6850S ribosomal protein L24P OS=Pyrobaculum islandic... [more]
RL24_METM72.758e-1441.4150S ribosomal protein L24P OS=Methanococcus maripa... [more]
RL24_METM52.758e-1441.4150S ribosomal protein L24P OS=Methanococcus maripa... [more]
RL24_SULSO4.705e-1444.0050S ribosomal protein L24P OS=Sulfolobus solfatari... [more]
RL24_PYRAE4.705e-1442.8650S ribosomal protein L24P OS=Pyrobaculum aerophil... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top