DC900380

Overview
NameDC900380
Unique NameDC900380
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length695
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig3221 contig Csv1_Contig3221:51..745. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_PYRCJ (50S ribosomal protein L24P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.026e-14
Identity = 42/98 (42.86%), Postives = 63/98 (64.29%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            S+  RK R + + AP  +RR L++A LS +L++K  V+ +PVR+ D V ++RG +KG  GKVV+V  ++  I +E  TR    G TV   I+PSKV+I
Sbjct:    6 SAQPRKQRLSLYAAPLHLRRKLLNAKLSPELQKKLGVKRLPVRRGDTVLIMRGDFKGVTGKVVKVDLKRVRIFVEGATRTNSRGQTVYYPIHPSKVMI 103          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METMP (50S ribosomal protein L24P OS=Methanococcus maripaludis GN=rpl24p PE=3 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 8.026e-14
Identity = 41/99 (41.41%), Postives = 63/99 (63.64%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S   RK RKA + AP  +R  +MSA L+ +L++KY   S+PV+K D V+V+RG +KG EG+V +V    + I +E +  +K +G+     I+PS V+IT
Sbjct:    6 SKQPRKQRKALYNAPLHLRNSVMSAMLAKELKEKYAKNSLPVKKGDTVKVLRGNFKGIEGEVSKVDYAGYKIIVEGVVNKKQDGNETAYPIHPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METVS (50S ribosomal protein L24P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.048e-13
Identity = 41/99 (41.41%), Postives = 62/99 (62.63%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S   RK RKA + AP  +R  +MSA LS  L++KY   ++PV+K D V+V+RG++KG EG+V +V    + I +E +  +K +G      I+PS V+IT
Sbjct:    6 SKQPRKQRKALYNAPLHLRNSVMSAMLSKALKEKYGKNALPVKKGDTVKVLRGSFKGIEGEVSKVNYSGYKIIVEGVVNKKQDGKETPYPIHPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METVA (50S ribosomal protein L24P OS=Methanococcus vannielii GN=rpl24p PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.048e-13
Identity = 41/99 (41.41%), Postives = 62/99 (62.63%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            S   RK RKA + AP  +R  +MSA LS  L++KY   ++PV+K D V+V+RG++KG EG+V +V    + I +E +  +K +G      I+PS V+IT
Sbjct:    6 SKQPRKQRKALYNAPLHLRNSVMSAMLSKALKEKYGKNALPVKKGDTVKVLRGSFKGIEGEVSKVNYSGYKIIVEGVVNKKQDGKETPYPIHPSNVMIT 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_CALMQ (50S ribosomal protein L24P OS=Caldivirga maquilingensis (strain DSMZ 13496 / IC-167) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.048e-13
Identity = 42/98 (42.86%), Postives = 62/98 (63.27%), Query Frame = 1
Query:   76 SSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVI 369
            SS  RK  KA   AP   RR L++APLS DL+++  +R +PVR  D V ++RG +KG  GKV +V  ++  I+++  + +K +G  V   I+PSKVVI
Sbjct:    7 SSQPRKQHKALTKAPWHARRRLLTAPLSKDLQRQLGIRRIPVRVGDTVLILRGDFKGTRGKVTRVDYKRVRIYVDSASFKKPSGEAVYYPIHPSKVVI 104          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METMA (50S ribosomal protein L24P OS=Methanosarcina mazei GN=rpl24p PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.788e-13
Identity = 43/100 (43.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS   RK RKA +TAP  +R+  M A LS  L ++Y  RS  V   D V+++RG +KG EGKV  V      I ++ +   KV+G+ V   INPS V+IT
Sbjct:    8 VSKQPRKQRKARYTAPLHIRQKFMGARLSEALAKQYGTRSAAVITGDTVKIMRGDFKGTEGKVQSVSLMDGTIAVDGVISTKVDGTEVPRPINPSNVMIT 107          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_ARCFU (50S ribosomal protein L24P OS=Archaeoglobus fulgidus GN=rpl24p PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.788e-13
Identity = 40/102 (39.22%), Postives = 65/102 (63.73%), Query Frame = 1
Query:   67 PRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            P+    R++ R  + TA    R  L+ A LS DLR+KY  R++ VRK D+V+++RG + G EG+V++V  ++  I ++ +T  K +G+ V V I+PS V+IT
Sbjct:    4 PKSKQPRKQRRWLYKTAKLHERHKLLHATLSKDLRKKYGKRAIRVRKGDKVRIMRGQFAGHEGRVLEVDMKRCRITVDGVTVTKADGTEVAVPIHPSNVMIT 105          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METTP (50S ribosomal protein L24P OS=Methanosaeta thermophila (strain DSM 6194 / PT) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.202e-13
Identity = 42/100 (42.00%), Postives = 62/100 (62.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS   RK RKA F AP  +R+  M A LS +LR++Y  RS  V+K D V+V+RG   G EG+V+ V  ++ VI +  ++  + +G+ V   I+PS V+IT
Sbjct:    2 VSKQPRKQRKARFNAPLHMRQRFMHAMLSPELRKEYKKRSAQVKKGDTVKVMRGDNAGVEGEVLSVDLKRCVITVAGVSNFRADGTEVPRPIHPSNVMIT 101          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL24_METBF (50S ribosomal protein L24P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl24p PE=3 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 6.794e-13
Identity = 44/100 (44.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query:   73 VSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRGTYKGREGKVVQVYRRKWVIHIERITREKVNGSTVNVGINPSKVVIT 372
            VS   RK RKA + AP  VR+  M A LS  L ++Y  RS  V   D V+V+RG YKG EGKV  V  +   I ++ +   KV+G+ V   I PS V+IT
Sbjct:    2 VSKQPRKQRKARYNAPLHVRQKFMGARLSEALSKEYGTRSAAVIAGDTVKVMRGDYKGTEGKVQAVSLQDGTISVDGVISTKVDGTEVPRPIYPSNVMIT 101          
BLAST of DC900380 vs. ExPASy Swiss-Prot
Match: RL26_BRUPA (60S ribosomal protein L26 (Fragment) OS=Brugia pahangi PE=3 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 8.874e-13
Identity = 38/60 (63.33%), Postives = 44/60 (73.33%), Query Frame = 1
Query:   55 MKYNPRVSSSRRKNRKAHFTAPSSVRRILMSAPLSTDLRQKYNVRSMPVRKDDEVQVVRG 234
            MK N  VSSS RK RKA F APS +RR LMSAP + DLR K+ +RS+P+R DDEV V RG
Sbjct:    1 MKQNQFVSSSARKARKAPFNAPSHIRRKLMSAPSTKDLRNKHGIRSIPIRIDDEVTVTRG 60          
The following BLAST results are available for this feature:
BLAST of DC900380 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 56
Match NameE-valueIdentityDescription
RL24_PYRCJ8.026e-1442.8650S ribosomal protein L24P OS=Pyrobaculum calidifo... [more]
RL24_METMP8.026e-1441.4150S ribosomal protein L24P OS=Methanococcus maripa... [more]
RL24_METVS1.048e-1341.4150S ribosomal protein L24P OS=Methanococcus vannie... [more]
RL24_METVA1.048e-1341.4150S ribosomal protein L24P OS=Methanococcus vannie... [more]
RL24_CALMQ1.048e-1342.8650S ribosomal protein L24P OS=Caldivirga maquiling... [more]
RL24_METMA1.788e-1343.0050S ribosomal protein L24P OS=Methanosarcina mazei... [more]
RL24_ARCFU1.788e-1339.2250S ribosomal protein L24P OS=Archaeoglobus fulgid... [more]
RL24_METTP5.202e-1342.0050S ribosomal protein L24P OS=Methanosaeta thermop... [more]
RL24_METBF6.794e-1344.0050S ribosomal protein L24P OS=Methanosarcina barke... [more]
RL26_BRUPA8.874e-1363.3360S ribosomal protein L26 (Fragment) OS=Brugia pah... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900380 VSS Citrus sinensis cDNA clone VS28952 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900380 ID=DC900380|Name=DC900380|organism=Citrus sinensis|type=EST|length=695bp
CTTCCTCTAGCTGCCGCTGTTGTAAAACCCTAGGCCCAGTCCTCCACATC
CACCATGAAGTACAACCCCAGGGTGTCATCCTCTCGCCGTAAGAACCGGA
AGGCGCACTTCACCGCCCCTTCCAGCGTGCGCCGCATCTTGATGAGCGCG
CCGCTGTCCACTGACCTCCGTCAGAAGTACAACGTAAGGTCGATGCCTGT
GCGCAAGGACGACGAGGTCCAGGTTGTCCGTGGGACCTACAAGGGGCGCG
AGGGCAAAGTCGTTCAAGTGTATCGCCGGAAGTGGGTCATTCACATCGAG
CGCATCACTCGCGAGAAGGTTAATGGATCCACTGTGAATGTGGGAATCAA
CCCATCAAAGGTCGTGATCACCAAGCTCCGTCTGGACAAGGACAGGAAGT
CTTTGCTCGATCGCAAGGCCAAGGGACGTGCCGCCGCTGACAAGGAGAAG
GGTACCAAGTTCACCCCAGAGGATATTATGCAGAGTGTTGACTAATTTTT
ATAAGAGGTTGTTTTTAAAGTTTTTGTTTAATCATAGATTTTATGGATTT
AGGATGTTTTGTTTTGGCAATGTCCCTAAGATATTTCTATTGTTATTGTG
TTATGCCNTGAGGATCCGATTATGGGCTTATGTTGGAGATTTAAGATACT
TCTTTGGATTTTCTCCNCGTCGTTTCNATTTTAATTCTATATTTT
back to top