DC900378

Overview
NameDC900378
Unique NameDC900378
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length546
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900378_ssr1 microsatellite DC900378_ssr1:1..24. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig978 contig Csv1_Contig978:5..550. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH2_MOUSE (Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.131e-11
Identity = 45/123 (36.59%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  +D   KP  FEL                       G + +Y + A T++EK+EWI SI  A+
Sbjct:  259 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVDD-PRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAV 375          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH2_HUMAN (Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2)

HSP 1 Score: 67.3958 bits (163), Expect = 5.131e-11
Identity = 45/123 (36.59%), Postives = 63/123 (51.22%), Query Frame = 1
Query:  151 NPERSGWLTKQGD-YIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFEL---------------------STGEYTMYFV-ADTEKEKEEWINSIGRAI 450
            NP+R GWL K G   +KTW+RRWFIL    L++F+     T    PRG+IP+   L++R  +D   KP  FEL                       G + +Y + A T++EK+EWI SI  A+
Sbjct:  259 NPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFE----YTTDKEPRGIIPLEN-LSIREVDD-PRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAV 375          
BLAST of DC900378 vs. ExPASy Swiss-Prot
Match: CYH4_MOUSE (Cytohesin-4 OS=Mus musculus GN=Cyth4 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.702e-11
Identity = 46/137 (33.58%), Postives = 67/137 (48.91%), Query Frame = 1
Query:  118 PEDYTG--IEFWSNPERSGWLTKQGDYIKTWRRRWFILKQGKLFWFKDSHNITPGSTPRGVIPVGTCLTVRGAEDLLNKPFAFELST---------------------GEYTMYFV-ADTEKEKEEWINSIGRAIVQ 456
            PED  G     + NP+R GWL K G  +KTW+RRWFIL    L++F+     T    PRG+IP+   L+V+  ED   KPF  EL                       G++  Y + A   +E+++WI +I  +I +
Sbjct:  246 PEDDGGDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFE----FTTDKEPRGIIPLEN-LSVQKVED-PKKPFCLELYNPSCRGQKIKACKTDGDGKVVEGKHESYRISAANAEERDQWIEAIRASITR 376          
The following BLAST results are available for this feature:
BLAST of DC900378 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 13
Match NameE-valueIdentityDescription
CYH2_MOUSE5.131e-1136.59Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=1[more]
CYH2_HUMAN5.131e-1136.59Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2[more]
CYH4_MOUSE6.702e-1133.58Cytohesin-4 OS=Mus musculus GN=Cyth4 PE=2 SV=1[more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900378 VSS Citrus sinensis cDNA clone VS28950 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900378 ID=DC900378|Name=DC900378|organism=Citrus sinensis|type=EST|length=546bp
CTCTCTCTCTCTCTCTCTCTCTCTCGCACAAAAGAAAAGACGACTGCCAA
TTGAGTAGAAAGTGCTTCAACTTCAATGGAGAATATCTGGCGTGCCTTGT
CGGGTCAGGACCCGAACCCGGAAGATTACACAGGCATAGAGTTCTGGTCT
AACCCGGAGCGATCGGGCTGGTTAACAAAGCAAGGCGACTACATCAAAAC
GTGGCGCCGCCGTTGGTTCATTCTGAAACAAGGCAAGCTCTTTTGGTTCA
AAGACTCCCACAACATCACCCCCGGCTCCACTCCACGTGGCGTCATCCCT
GTGGGCACTTGCCTCACCGTCAGGGGCGCCGAGGACCTTCTGAACAAACC
CTTCGCCTTCGAGCTCTCCACGGGGGAATACACGATGTACTTTGTGGCGG
ATACTGAGAAGGAGAAAGAGGAGTGGATCAATTCGATTGGCCGCGCGATT
GTTCAGCACTCGCGCTCGGTGACTGAATCCGAAGTCGTTGATTATGATAA
CAAATGATGATTGGTTTGTGAAATTTTCAATTTCTTAAATTTACTG
back to top