DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_NEUCR (Translationally-controlled tumor protein homolog OS=Neurospora crassa GN=NCU06464 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.365e-22
Identity = 65/173 (37.57%), Postives = 96/173 (55.49%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE------ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            ML+Y D++TGDE++SDS+  KE++ GI +EV+   + +GAV VDIGAN S               KV ++V +FRLQ    FDKK ++ Y+K ++K +   L E      E ++   K    A   +L+K  D +F+ GESM+ DG +V   Y+E  T P  +     LKE K
Sbjct:    1 MLIYSDIITGDEIISDSYDLKEVD-GIAYEVDCAMIEEGAVQVDIGANASAEEADEALDDGVV--KVNNVVHSFRLQSTQ-FDKKGYLVYLKGYMKSVKNALKEQGKSDEEIKDFETKASAFAKNVILAKFKDWEFYTGESMNPDGMVVLLNYREDGTTPYVVVWKHGLKETK 169          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP1_DICDI (Translationally-controlled tumor protein homolog 1 OS=Dictyostelium discoideum GN=DDB_G0282853 PE=3 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 2.365e-22
Identity = 64/174 (36.78%), Postives = 98/174 (56.32%), Query Frame = 2
Query:   86 MLVYQDLL--TGDELLSDSFPYKEIENGILWEVEGKWV-VQGAVDVDIGANPSXXXXXXXXXXXXXXXK-VVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEE---RQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M V++D++  + DEL SD++P  EI NG+++EV+ K V +   V V+ GAN +               K V+++VD  RL E  +FDKK +  Y+K ++K +  KL++    R + FKK+     K +L K  + +F+ GE+M  DG +   YYK G  DP FLY  D L+ VK
Sbjct:    1 MRVFKDIVGYSHDELCSDAYPMTEINNGLIYEVQAKMVTIDLDVKVNTGANAASEETEEDEGVDNAGSKQVINVVDAMRLVET-SFDKKSYTGYIKAYMKEVLAKLADNNPSRVDAFKKDAADFVKSVLGKFDEYKFYTGENMDADGHVALMYYKPGEVDPIFLYFKDGLESVK 173          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_DANRE (Translationally-controlled tumor protein homolog OS=Danio rerio GN=tpt1 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 6.882e-22
Identity = 61/174 (35.06%), Postives = 92/174 (52.87%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+D++TGDE+ SD +  KE ENG++ EVEGK + +   D+D   IG N S                 VDIV   +LQE  ++DKK +  Y+K ++K +  KL E    R + F  N     K +L  + + QFF GESM+ DG +    ++E    P  ++  D L+  KC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMLEVEGKMITRAEGDIDDALIGGNASAEVADEGCDSTSVSG--VDIVLNHKLQE-TSYDKKSYTAYIKDYMKAVKAKLQESAPNRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMIFFKDGLEIEKC 171          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_KLULA (Translationally-controlled tumor protein homolog OS=Kluyveromyces lactis GN=KLLA0C12716g PE=3 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 8.988e-22
Identity = 59/157 (37.58%), Postives = 91/157 (57.96%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQE---IFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDP 547
            M++Y D+++GDELLSD++  K ++ G+++E +   V  G  ++DIGANPS                V ++V +FRLQ Q AFDKK F+TY+K ++K +  +L E   +   +F+K  +   K ++    D +FF GESM  DG LV   Y+E  T P
Sbjct:    1 MIIYTDIISGDELLSDAYDLKLVD-GVIYEADCDMVKVGGDNIDIGANPSAEDGGDDVEDGTEL--VNNVVHSFRLQ-QTAFDKKSFLTYIKGYMKEIKGRLQESNPDEVSVFEKGAQAYVKKVIGSFKDWEFFTGESMDPDGMLVLLNYREDGTTP 153          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_LABRO (Translationally-controlled tumor protein homolog OS=Labeo rohita GN=tpt1 PE=2 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 1.533e-21
Identity = 61/174 (35.06%), Postives = 93/174 (53.45%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVD---IGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+D++TGDE+ SD +  KE ENG++ EVEGK + +   ++D   IG N S                 VDIV   +LQE  ++DKK +  Y+K ++K +  KL E   +R + F  N     K +L  + + QFF GESM+ DG +    ++E    P  L+  D L+  KC
Sbjct:    1 MIIYKDIITGDEMFSDIYKIKESENGMMIEVEGKMISRAEGEIDDALIGGNASAEVQDEGCESTTVSG--VDIVLNHKLQE-TSYDKKSYTAYIKDYMKAVKAKLQEVAPDRVDPFMANAPAEVKKILGNIKNFQFFTGESMNPDGMIGLLDFREDGVTPYMLFFKDGLEIEKC 171          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_SCHPO (Translationally-controlled tumor protein homolog OS=Schizosaccharomyces pombe GN=p23fy PE=1 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 9.937e-21
Identity = 61/171 (35.67%), Postives = 99/171 (57.89%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV-VQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            ML+Y+D+++GDEL+SD++  KE+++ I++E + + V V+   DVDIGANPS                V ++V +FRL    +FDKK +++Y+K ++K +  +L E   ER  +F+KN  G  K +L+   D  F++GESM  D  +V   Y+E    P  ++  D L   K
Sbjct:    1 MLLYKDVISGDELVSDAYDLKEVDD-IVYEADCQMVTVKQGGDVDIGANPSAEDAEENAEEGTET--VNNLVYSFRLSPT-SFDKKSYMSYIKGYMKAIKARLQESNPERVPVFEKNAIGFVKKILANFKDYDFYIGESMDPDAMVVLMNYREDGITPYMIFFKDGLVSEK 167          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PSEMX (Translationally-controlled tumor protein homolog OS=Psetta maxima GN=tpt1 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.776e-20
Identity = 61/173 (35.26%), Postives = 90/173 (52.02%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAV--DVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DLL+GDE+ S+ +  +E+E GIL EVEGK + +     D   GANPS                 VDI+   +L     ++KK +  Y+K+++K L  KL E   ER + F     GA K +L K  D +F+ GESM+ D  +    Y+E    P  L+  D L+  KC
Sbjct:    1 MIIYKDLLSGDEMFSNIYKIRELEGGILLEVEGKRITRTEAIDDSAFGANPSAEELSEANEAAVSSG--VDIILNHKLIST-LYNKKQYSAYIKKYMKDLKTKLEETNPERVDAFVAGAVGAVKMILGKFKDFEFYTGESMNHDAMVGLLDYREDGITPIMLFFKDGLEIEKC 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_AEDAL (Translationally-controlled tumor protein homolog OS=Aedes albopictus GN=Tctp PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.776e-20
Identity = 66/173 (38.15%), Postives = 91/173 (52.60%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQ---EIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            M +++D+ TGDE+ SD++  K I+N +++EV GK V +   DV + GANPS                 VDIV   RL E    DKK F TY+K ++K L  +L E      E+FK NI    K LL +  DLQFF GESM  +G +    Y+  +G + P  L     L+E K
Sbjct:    1 MKIWKDIFTGDEMFSDTYKVKLIDN-VMYEVYGKHVSRTLGDVQLDGANPSAEEADEGTDAATESG--VDIVLNHRLVETGFADKKQFTTYLKDYMKKLVTRLEENNPSEVEVFKTNINKVMKDLLGRFKDLQFFTGESMDCEGLIAMLEYRDIDGESTPILLCFKHGLEEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_AEDAE (Translationally-controlled tumor protein homolog OS=Aedes aegypti GN=Tctp PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 3.776e-20
Identity = 65/173 (37.57%), Postives = 91/173 (52.60%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQ---EIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            M +++D+ TGDE+ SD++  K ++N +++EV GK V +   DV + GANPS                 VDIV   RL E    DKK F TY+K ++K L  +L E      E+FK NI    K LL +  DLQFF GESM  +G +    Y+  +G + P  L     L+E K
Sbjct:    1 MKIWKDIFTGDEMFSDTYKLKLVDN-VMYEVYGKHVSRTLGDVQLDGANPSAEEADEGTDNATESG--VDIVLNHRLVETGFADKKQFTTYLKDYMKKLVTRLEENNPSEVEVFKTNINKVMKDLLGRFKDLQFFTGESMDCEGLIAMLEYRDIDGESTPVLLCFKHGLEEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_CANGA (Translationally-controlled tumor protein homolog OS=Candida glabrata GN=CAGL0L12870g PE=3 SV=1)

HSP 1 Score: 97.8265 bits (242), Expect = 6.441e-20
Identity = 58/170 (34.12%), Postives = 91/170 (53.53%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEI---FKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++Y+D+ +GDELLSD++   E++ G+++E +   V  G  ++DIGANPS                V ++V +FRLQ    FDKK F+TY+K ++K +  KL E+  +    F+K  +   K ++    D +FF GESM  D  +V   Y+E  T P        + E K
Sbjct:    1 MIIYKDIFSGDELLSDAYDINEVD-GVIYEADCAMVKVGGDNIDIGANPSTEDGEDDVEDGTEV--VNNVVHSFRLQPT-GFDKKSFLTYIKGYMKAVKAKLQEKNPDAIPTFEKGAQVYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTPFVAIWKHGIDEEK 166          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_NEUCR2.365e-2237.57Translationally-controlled tumor protein homolog O... [more]
TCTP1_DICDI2.365e-2236.78Translationally-controlled tumor protein homolog 1... [more]
TCTP_DANRE6.882e-2235.06Translationally-controlled tumor protein homolog O... [more]
TCTP_KLULA8.988e-2237.58Translationally-controlled tumor protein homolog O... [more]
TCTP_LABRO1.533e-2135.06Translationally-controlled tumor protein homolog O... [more]
TCTP_SCHPO9.937e-2135.67Translationally-controlled tumor protein homolog O... [more]
TCTP_PSEMX3.776e-2035.26Translationally-controlled tumor protein homolog O... [more]
TCTP_AEDAL3.776e-2038.15Translationally-controlled tumor protein homolog O... [more]
TCTP_AEDAE3.776e-2037.57Translationally-controlled tumor protein homolog O... [more]
TCTP_CANGA6.441e-2034.12Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top