DC900376

Overview
NameDC900376
Unique NameDC900376
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Libraries
Library NameType
VSScdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
DC900376_ssr9 microsatellite DC900376_ssr9:9..30. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig4376 contig Csv1_Contig4376:165..904. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_LATJA (Translationally-controlled tumor protein homolog OS=Lateolabrax japonicus GN=tpt1 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 1.099e-19
Identity = 61/173 (35.26%), Postives = 91/173 (52.60%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQ--GAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQE---IFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+ +++GDE+ SD+F  KE  NGI +EV+GK   +     D  I AN S                 VDIV   +LQE  +FDKK +  Y+K ++K +  KL EE+ E    F  ++    K +L+ L + QFF GE+M+ +G +    Y+E  T P  L+  D L   KC
Sbjct:    1 MIIYKCIISGDEMFSDAFKVKESANGIFYEVDGKITTRTDNIDDSLISANASAEETTDCTDSSVVSG--VDIVLNHKLQET-SFDKKSYKVYIKDYVKAIKQKLQEEKPERVDAFMADVAEEVKEILNNLKNYQFFTGENMNPEGMVGLLDYREDGTTPYMLFFKDGLLAEKC 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_YARLI (Translationally-controlled tumor protein homolog OS=Yarrowia lipolytica GN=YALI0E27071g PE=3 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.435e-19
Identity = 56/170 (32.94%), Postives = 93/170 (54.71%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++++D+++ DE+ SD+F  K ++N +++EV+   +     DVDIGANPS                V ++V +FRLQ    FDKK ++TY+K ++K +   L+E   E  E F+K  +   K +++   D  F+ GESM  DG +    Y+E  T P  ++    +KE K
Sbjct:    1 MIIFKDVISNDEMCSDAFEPKVVDN-VVYEVDCTMIQVAEGDVDIGANPSAEDAEEGVDSDVQT--VNNVVHSFRLQST-GFDKKSYLTYLKGYMKSIKNYLAENKPEEVENFEKGAQAYAKKIVANFKDFDFYTGESMDPDGMVALLNYREDGTTPYLIFWKHGIKEEK 166          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_RAT (Translationally-controlled tumor protein OS=Rattus norvegicus GN=Tpt1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.435e-19
Identity = 58/173 (33.53%), Postives = 92/173 (53.18%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV--VQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DEL SD +  +EI +G+  EVEGK V   +GA+D  +    +                 VDIV    LQE  +F K+ +  Y+K ++K L  KL E++ E  K  + GA    K +L+  ++ QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRTEGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQET-SFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_MOUSE (Translationally-controlled tumor protein OS=Mus musculus GN=Tpt1 PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 1.435e-19
Identity = 58/173 (33.53%), Postives = 92/173 (53.18%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWV--VQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQEIFKKNIEGAT---KFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVKC 589
            M++Y+DL++ DEL SD +  +EI +G+  EVEGK V   +GA+D  +    +                 VDIV    LQE  +F K+ +  Y+K ++K L  KL E++ E  K  + GA    K +L+  ++ QFF+GE+M+ DG +    Y+E    P  ++  D L+  KC
Sbjct:    1 MIIYRDLISHDELFSDIYKIREIADGLCLEVEGKMVSRTEGAIDDSLIGGNASAEGPEGEGTESTVVTGVDIVMNHHLQET-SFTKEAYKKYIKDYMKSLKGKLEEQKPERVKPFMTGAAEQIKHILANFNNYQFFIGENMNPDGMVALLDYREDGVTPFMIFFKDGLEMEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_DROYA (Translationally-controlled tumor protein homolog OS=Drosophila yakuba GN=Tctp PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 3.197e-19
Identity = 60/175 (34.29%), Postives = 96/175 (54.86%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKE--GATDPTFLYMADALKEVKC 589
            M +Y+D++TGDE+ +D++  K ++  +++EV GK + +   D+ + GAN S                 VD+V   RLQE  AF DKK +  Y+K ++K +  KL E   ++ ++FK N+  A K +L +  +LQFF GESM  DG +    Y+E  G + P  ++    L E KC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDE-VIYEVYGKLITRQGDDIKLEGANASAEEADEGTDITSESG--VDVVLNHRLQECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDVFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLDEEKC 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ANOGA (Translationally-controlled tumor protein homolog OS=Anopheles gambiae GN=Tctp PE=3 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 3.197e-19
Identity = 64/173 (36.99%), Postives = 92/173 (53.18%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQ---EIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYK--EGATDPTFLYMADALKEVK 586
            M +++D+ TGDE+ SD++  K +++ +++EV GK V +   DV + GANPS                 VDIV   RL E    DKK F TY+K ++K L  +L E+     E+FK NI    K LL +  DLQFF GESM  +G +    Y+  +G + P  L     L+E K
Sbjct:    1 MKIWKDVFTGDEMFSDTYKVKLVDD-VMYEVYGKHVSRTLGDVQLDGANPSAEEAEEGTESATESG--VDIVLNHRLVETGFSDKKQFTTYLKDYMKKLVTRLEEKSPGEVEVFKTNINKVMKDLLGRFKDLQFFTGESMDCEGLIAMLEYRDIDGESVPVLLCFKHGLEEEK 170          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_YEAST (Translationally-controlled tumor protein homolog OS=Saccharomyces cerevisiae GN=TMA19 PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.175e-19
Identity = 57/157 (36.31%), Postives = 88/157 (56.05%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDIGANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFDKKPFVTYMKRFIKLLTPKLSEERQE---IFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDP 547
            M++Y+D+ + DELLSD++  K +++ +++E +   V  G  ++DIGANPS                V ++V +FRLQ Q AFDKK F+TY+K ++K +  KL E   E    F+K  +   K ++    D +FF GESM  D  +V   Y+E  T P
Sbjct:    1 MIIYKDIFSNDELLSDAYDAKLVDD-VIYEADCAMVNVGGDNIDIGANPSAEGGDDDVEEGAEM--VNNVVHSFRLQ-QTAFDKKSFLTYIKGYMKAVKAKLQETNPEEVPKFEKGAQTYVKKVIGSFKDWEFFTGESMDPDAMVVMLNYREDGTTP 153          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_PLUXY (Translationally-controlled tumor protein homolog OS=Plutella xylostella GN=Tctp PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.175e-19
Identity = 62/174 (35.63%), Postives = 93/174 (53.45%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKE--GATDPTFLYMADALKEVK 586
            M +Y+D++TGDE+ SD++  K ++  +++EV GK V +   DV I G NPS                 VDIV   RL E  AF DKK +  Y+K ++K L  KL E   ++ ++FK N+    K +L +  +LQFF GESM  DG +    Y++  G + P  ++    L E K
Sbjct:    1 MRIYKDIITGDEMFSDTYKMKLVDE-VIYEVTGKLVTRTHGDVQIEGFNPSAEEADEGTDAATESG--VDIVLNHRLMETYAFGDKKSYTLYLKDYMKKLVAKLEETAPDQVDVFKTNMNKVMKDILGRFKELQFFTGESMDCDGMVAMCEYRDINGVSTPVMMFFKHGLLEEK 171          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_ASPOR (Translationally-controlled tumor protein homolog OS=Aspergillus oryzae GN=AO090005000996 PE=3 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 4.175e-19
Identity = 60/173 (34.68%), Postives = 90/173 (52.02%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAFD----KKPFVTYMKRFI-KLLTPKLSEERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKEGATDPTFLYMADALKEVK 586
            M++Y+D+LTGDE++SD+F  KE++N ILWEV+ + +  G  ++ + GANPS               +V+DI   FRL + P  +    KK    YMK+ + KL   K  EE  + FK+N + A K +L+   D    VGES   D   +   Y+E    P   +    L+E K
Sbjct:    1 MIIYKDILTGDEIISDAFNLKEVDN-ILWEVDCRNITIGDENIQLEGANPSAEGEDDDAGGAGNAEQVLDIKHNFRLNDYPKLEKDEYKKAIKGYMKKVLAKLEEKKAPEETIKEFKENAQTALKRILANYKDYDVLVGESFGADAMHILINYREDGVTPYATFWKHGLEEYK 172          
BLAST of DC900376 vs. ExPASy Swiss-Prot
Match: TCTP_DROME (Translationally-controlled tumor protein homolog OS=Drosophila melanogaster GN=Tctp PE=1 SV=1)

HSP 1 Score: 94.7449 bits (234), Expect = 5.453e-19
Identity = 60/175 (34.29%), Postives = 97/175 (55.43%), Query Frame = 2
Query:   86 MLVYQDLLTGDELLSDSFPYKEIENGILWEVEGKWVVQGAVDVDI-GANPSXXXXXXXXXXXXXXXKVVDIVDTFRLQEQPAF-DKKPFVTYMKRFIKLLTPKLSE---ERQEIFKKNIEGATKFLLSKLSDLQFFVGESMHDDGCLVFAYYKE--GATDPTFLYMADALKEVKC 589
            M +Y+D++TGDE+ +D++  K +++ +++EV GK + +   D+ + GAN S                 VD+V   RL E  AF DKK +  Y+K ++K +  KL E   ++ +IFK N+  A K +L +  +LQFF GESM  DG +    Y+E  G + P  ++    L+E KC
Sbjct:    1 MKIYKDIITGDEMFADTYKMKLVDD-VIYEVYGKLITRQGDDIKLEGANASAEEADEGTDITSESG--VDVVLNHRLTECFAFGDKKSYTLYLKDYMKKVLAKLEEKSPDQVDIFKTNMNKAMKDILGRFKELQFFTGESMDCDGMVALVEYREINGDSVPVLMFFKHGLEEEKC 172          
The following BLAST results are available for this feature:
BLAST of DC900376 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 73
Match NameE-valueIdentityDescription
TCTP_LATJA1.099e-1935.26Translationally-controlled tumor protein homolog O... [more]
TCTP_YARLI1.435e-1932.94Translationally-controlled tumor protein homolog O... [more]
TCTP_RAT1.435e-1933.53Translationally-controlled tumor protein OS=Rattus... [more]
TCTP_MOUSE1.435e-1933.53Translationally-controlled tumor protein OS=Mus mu... [more]
TCTP_DROYA3.197e-1934.29Translationally-controlled tumor protein homolog O... [more]
TCTP_ANOGA3.197e-1936.99Translationally-controlled tumor protein homolog O... [more]
TCTP_YEAST4.175e-1936.31Translationally-controlled tumor protein homolog O... [more]
TCTP_PLUXY4.175e-1935.63Translationally-controlled tumor protein homolog O... [more]
TCTP_ASPOR4.175e-1934.68Translationally-controlled tumor protein homolog O... [more]
TCTP_DROME5.453e-1934.29Translationally-controlled tumor protein homolog O... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionDC900376 VSS Citrus sinensis cDNA clone VS28946 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>DC900376 ID=DC900376|Name=DC900376|organism=Citrus sinensis|type=EST|length=744bp
CCGCTGCGTCTCTCTCTCTCTCTCTCTCTCCAGTTTTCTCCGTTGATTAT
TTTTCTTTTTTGTGTTCGCGAGAGAGACTGCAATCATGTTGGTCTATCAA
GATCTCCTCACCGGTGATGAGCTTCTCTCCGATTCTTTTCCCTACAAGGA
AATTGAGAATGGGATTCTGTGGGAAGTTGAGGGAAAGTGGGTTGTACAAG
GAGCCGTTGATGTTGACATTGGTGCAAATCCTTCTGCCGAAGGAGCTGAT
GAGGATGAGGGTGTTGATGACCAAGCCGTGAAGGTGGTTGACATTGTCGA
CACATTCAGGCTACAGGAGCAACCCGCTTTTGACAAGAAGCCGTTTGTAA
CATACATGAAGAGATTCATCAAGTTGCTGACGCCCAAGCTGAGTGAGGAG
AGGCAGGAGATATTTAAGAAGAATATTGAGGGAGCGACCAAGTTCTTGCT
CTCGAAGCTCAGTGACCTTCAATTCTTTGTTGGGGAGAGCATGCATGATG
ATGGCTGTCTTGTCTTTGCTTACTACAAGGAAGGTGCGACCGACCCAACA
TTTTTGTATATGGCTGATGCATTGAAGGAGGTGAAGTGCTAAGCTGGGCT
TCGAAGAGGAAGTGCCTGCTGTAGTTCTAATTTTAATTATTGCCCGCGGT
TATTTTTATGTATCTTTTGTGCTGGTTTACTCGGGACTTGTGCTTGCTGT
TTTTTAGTTTTTATTTTGACATAAACAATATGTTTTTCTGCTCT
back to top